-
No products found
because this supplier's products are not listed.
Gopalakrishnan Thamil Selvan, et al.,
bioRxiv - Microbiology 2021
Quote:
... Glycerol stocks were made with 50% sterile glycerol and stored at −80 °C in an ultralow freezer (NuAire, USA) till use.
-
No products found
because this supplier's products are not listed.
Eric Waltari, et al.,
bioRxiv - Immunology 2019
Quote:
... Blocking solution (sciBLOCK Protein D1M solution, Scienion) was added at 200 μL/well with a multichannel pipet and allowed to incubate without agitation for 1 hour ...
-
No products found
because this supplier's products are not listed.
Ly Porosk, et al.,
bioRxiv - Biochemistry 2022
Quote:
... Peptide-based transfection reagent Reagent007 from Icosagen suitable for suspension cells ...
-
No products found
because this supplier's products are not listed.
Robin S. Lindsay, et al.,
bioRxiv - Immunology 2021
Quote:
... 1µg/ml of 8.3 peptide (KYNKANVEL) (Chi Scientific), or 100ng/ml of OT-I peptide (SIINFEKL ...
-
No products found
because this supplier's products are not listed.
Shushan Sargsian, et al.,
bioRxiv - Microbiology 2023
Quote:
... Glycerol stocks of the OA isolates were streaked onto BRU agar plates (Anaerobe Systems) and incubated anaerobically for 48 hours at 37°C ...
-
No products found
because this supplier's products are not listed.
Kamyab Javanmardi, et al.,
bioRxiv - Biochemistry 2021
Quote:
... Membranes were blocked in LICOR Odyssey Blocking Buffer (Neta Scientific) incubated with the following primary antibodies overnight ...
-
No products found
because this supplier's products are not listed.
Casandra Ai Zhu Tan, et al.,
bioRxiv - Microbiology 2022
Quote:
... Glycerol stocks of the 5,000 mutants were grown overnight in BHI medium (Neogen, Lansing, USA) for 15 - 18 h at 37 °C ...
-
Atrial Natriuretic Peptide ( ANP ) ELISA / Assay Kit
Cat# K071-H1,
1.0 ea, USD $385.0
Ask
Soon Yew Tang, et al.,
bioRxiv - Pharmacology and Toxicology 2020
Quote:
Atrial natriuretic peptide (Arbor Assays, K026-H1, Ann Arbor, MI), total nitrate+nitrite (Cayman Chemical ...
-
No products found
because this supplier's products are not listed.
Marc Sunden, et al.,
bioRxiv - Biochemistry 2023
Quote:
A peptide (NH2-KKKYPGGSTPVSSANMM-COOH) containing an O-GlcNAcylation site of human Casein kinase II subunit alpha (underlined sequence) was custom synthesized by Nordic BioSite. A mixture of 6 mM glutaraldehyde ...
-
No products found
because this supplier's products are not listed.
Qingxia Zhao, et al.,
bioRxiv - Immunology 2021
Quote:
... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.
-
No products found
because this supplier's products are not listed.
Susan Klaeger, et al.,
bioRxiv - Biochemistry 2021
Quote:
... Peptides were loaded onto an analytical column (25-30cm, 1.9um C18 (Dr. Maisch HPLC GmbH), packed in-house PicoFrit 75 μm inner diameter ...
-
No products found
because this supplier's products are not listed.
The Nhu Nguyen, et al.,
bioRxiv - Microbiology 2023
Quote:
Antibody responses against IAV-S nucleoprotein (NP) were measured by using a commercial blocking ELISA (IDEXX, Montpellier, France), following the manufacturer’s recommendation ...
-
No products found
because this supplier's products are not listed.
Anuj kumar Murmu, et al.,
bioRxiv - Genomics 2022
Quote:
The predicted peptide sequence of Mucin 2 of indigenous duck was derived by Edit sequence (Lasergene Software, DNASTAR) and then aligned with the peptide of other chicken breed and avian species using Megalign sequence Programme of Lasergene Software ...
-
No products found
because this supplier's products are not listed.
Sophie Robitaille, et al.,
bioRxiv - Microbiology 2020
Quote:
... Confirmation was performed using a Western-Blot with anti-His antibodies (Mouse antibodies to 6His-peptide) (Meridian Life Science) and Coomassie blue coloration to confirm protein purity.
-
No products found
because this supplier's products are not listed.
Colton D. Payne, et al.,
bioRxiv - Biochemistry 2020
Quote:
... The resin used as an anchor for peptide assembly was Tentagel XV 4-hydroxymethyl phenoxyacetic acid (Rapp Polymere, GmbH). Prior to the loading of the C-terminal residue ...
-
No products found
because this supplier's products are not listed.
Bradly Burke, et al.,
bioRxiv - Microbiology 2023
Quote:
... Red blood cells were lysed with ammonium chloride buffer and 106 splenocytes from each bat were cultured with 1 µg of SARS-CoV-2 PepTivator® SARS-CoV-2 Prot_N peptide library (15mers with 12 residue overlaps, Miltenyi) for 6 hours in 5% FBS Clicks medium (Fujifilm/Irvine Scientific) and 1 µg of anti-mouse CD40 monoclonal antibody (FGK45 ...
-
Cat# PR-04,
25 micrograms,USD $200.0
Ask
Stephen P. Persaud, et al.,
bioRxiv - Immunology 2020
Quote:
... non-interaction of these two components was ensured by using non-biotinylated antibodies and sAV-SAP whose biotin-binding sites were occupied by an irrelevant biotinylated 11-mer peptide (BLANK Streptavidin-SAP, Advanced Targeting Systems). For experiments in which free antibody or sAV-SAP were administered alone ...
-
No products found
because this supplier's products are not listed.
Lesia Rodriguez, et al.,
bioRxiv - Plant Biology 2022
Quote:
... affinity-purified TMK1 (1:1000, 59), AHA2 (1:1000, 73) and PIN2 (1:1000, 35) antibodies and anti-ROP6 (C) (1:1000, Abiocode), using anti-Rabbit HRP-conjugated (1:5000 ...
-
No products found
because this supplier's products are not listed.
Aske L. Ejdrup, et al.,
bioRxiv - Cell Biology 2022
Quote:
... anti-hNET at 1:1000 (MAb Technologies, NET17-1) and anti-EEA1 at 1:1000 (Abcam ...
-
No products found
because this supplier's products are not listed.
Manami Suzuki-Karasaki, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... 1 μM OxiOrangeTM or 1 μM HydropTM (Goryo Chemicals, Sapporo, Japan) for 20 min ...
-
No products found
because this supplier's products are not listed.
Charlie J. Childs, et al.,
bioRxiv - Bioengineering 2023
Quote:
... Human Fibrinogen 1 Plasminogen Depleted (Enzyme Research Lab Cat#FIB-1), and X-Vivo 20 (Lonza Cat#190995) ...
-
No products found
because this supplier's products are not listed.
Maxwell P. Bui-Marinos, et al.,
bioRxiv - Immunology 2021
Quote:
... and RNA quality was examined by electrophoresing 1 μg of RNA on a 1% agarose gel containing 1% bleach (Aranda et al., 2012) and 1 × RedSafe nucleic acid staining solution (FroggaBio) in 1 × TAE buffer at 100 V for 35 min ...
-
No products found
because this supplier's products are not listed.
Wenzhi Feng, et al.,
bioRxiv - Cell Biology 2021
Quote:
... polyclonal anti-Hexokinase 1 rabbit IgG (United States Biological, 169073, 1:10000), polyclonal anti-NDT80 rabbit IgG (1:10000) ...
-
No products found
because this supplier's products are not listed.
Geoffrey L. Rogers, et al.,
bioRxiv - Immunology 2023
Quote:
... 1 µg of His-tagged HIV-1 JR-CSF gp120 (Immune Technology) was added to cells for 15 min at room temperature ...
-
No products found
because this supplier's products are not listed.
Giorgio Anselmi, et al.,
bioRxiv - Immunology 2019
Quote:
... 1% BSA (Apollo Scientific) and 2 mM EDTA (Life Technologies) ...
-
No products found
because this supplier's products are not listed.
Görkem Garipler, et al.,
bioRxiv - Developmental Biology 2020
Quote:
... 1 mM DSG (ProteoChem) was used for crosslinking at RT for 15min ...
-
No products found
because this supplier's products are not listed.
Akash D. Chakraborty, et al.,
bioRxiv - Physiology 2023
Quote:
... SERCA2 (1:5000, Badrilla), CSQ2 (1:3000 ...
-
No products found
because this supplier's products are not listed.
Ewan Phillip Ramsay, et al.,
bioRxiv - Biochemistry 2020
Quote:
HeLa cells were transfected with a 1:1:1 mix of gRNA1 and gRNA2 vectors together with the donor plasmid using PolyJet transfection reagent (SL100688, SignaGen Laboratories) according to the manufacturer’s instructions ...
-
magnetofection
difficult to transfect cells
Cat# KC30296,
PolyMag 100µL+PolyMag Neo100µL+ CombiMag 100µL+Magnetic Plate MF96000, USD $640.63/KIT
Ask
Andrew S. Flies, et al.,
bioRxiv - Immunology 2020
Quote:
... Digested proteins in PBS were diluted 1:1 in Squalvax (Oz Biosciences # SQ0010) to a final concentration of 0.1 μg/μL and was mixed using interlocked syringes to form an emulsion ...
-
No products found
because this supplier's products are not listed.
Sangeeta Ghuwalewala, et al.,
bioRxiv - Developmental Biology 2022
Quote:
... Mice were fed with doxy chow (1 g doxy/1 kg, Bio-serv) for the indicated chase periods ...
-
No products found
because this supplier's products are not listed.
Piotr T. Wysocki, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... and MCDB-105 (Cell Applications, San Diego, CA, USA; ratio 2:1:1). Culture media were supplemented with 10% fetal bovine serum (FBS ...
-
No products found
because this supplier's products are not listed.
Kristina Thamm, et al.,
bioRxiv - Cell Biology 2021
Quote:
... The digest was diluted 1:1 with CnT-PR-MSC-XF-HC (CELLnTEC, Bern, Switzerland), a chemically defined ...
-
Native Toxin
Cat# PT-TNG-200,
200µg USD $519.0
Ask
Emanuele Andreano, et al.,
bioRxiv - Immunology 2020
Quote:
... were coated with 25 μl/well of antigen (1:1 mix of S1 and S2 subunits, 1 μg/ml each; The Native Antigen Company, Oxford, United Kingdom) diluted in coating buffer (0.05 M carbonate-bicarbonate solution ...
-
No products found
because this supplier's products are not listed.
Tiphaine Péresse, et al.,
bioRxiv - Cell Biology 2019
Quote:
... 1% antibiotics (Zell Shield, Minerva Biolabs) and were incubated at 37°C in a 5% CO2 humidified atmosphere ...
-
No products found
because this supplier's products are not listed.
B. Afzali, et al.,
bioRxiv - Immunology 2019
Quote:
... anti-ubiquitin VU-1 (Tebu-bio), anti-HA (Covance) ...
-
No products found
because this supplier's products are not listed.
Andreas Damianou, et al.,
bioRxiv - Microbiology 2020
Quote:
... 20 μl mL−1 proteoloc (Expedeon), 0.17 complete protease inhibitor tablets mL−1 (Sigma) ...
-
No products found
because this supplier's products are not listed.
Carla Merino, et al.,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
4-(Methylnitrosamino)-1-(3-pyridyl)-1-butanone (NNK) was obtained from LGC-Dr Ehrenstorfer (LGC Standards, Barcelona, Spain) and 4-Hydroxy-4-(3-pyridyl)-butyric acid (HPBA ...
-
No products found
because this supplier's products are not listed.
Celine Everaert, et al.,
bioRxiv - Molecular Biology 2019
Quote:
... and 1 µl reaction buffer (ArcticZymes 66001). Of the resulting volume ...
-
No products found
because this supplier's products are not listed.
Yikun Xing, et al.,
bioRxiv - Microbiology 2023
Quote:
... The organs were homogenized in 1 ml 1× PBS using a BeadBlaster Refrigerated Homogenizer (Benchmark Scientific Inc, Sayreville, NJ, USA), and the organ homogenates were plated on LB agar plates and incubated at 37L to determine the number of bacteria or colony-forming units (CFU ...
-
No products found
because this supplier's products are not listed.
Serena R.G. Page, et al.,
bioRxiv - Plant Biology 2020
Quote:
... 1 mL/L of B5 vitamins (Phytotechnology Laboratories), and 0.5 μM TDZ (Fisher Scientific ...
-
No products found
because this supplier's products are not listed.
Maximiliano José Nigro, et al.,
bioRxiv - Neuroscience 2022
Quote:
... Rabbit IgG anti-SST (1:1000, BMA Biomedicals), Rabbit IgG anti-VIP (1:1000 ...
-
No products found
because this supplier's products are not listed.
Philip Kawalec, et al.,
bioRxiv - Physiology 2022
Quote:
... Serum Troponin-I was measured using the Ultra-Sensitive Mouse Cardiac Troponin-I ELISA Kit purchased from Life Diagnostics (CTNI-1-US; Life Diagnostics; West Chester, PA).
-
No products found
because this supplier's products are not listed.
Manon Janet-Maitre, et al.,
bioRxiv - Microbiology 2023
Quote:
... anti-Ef-TU (1/10,000, mouse, Hycult biotech), anti-XcpY (1/2,000 ...
-
No products found
because this supplier's products are not listed.
Jessica B. Sarthi, et al.,
bioRxiv - Physiology 2023
Quote:
... Mice were anesthetized with oxygen-delivered isoflurane (1-3%) at 1 L/min via a vaporizer (Braintree Scientific, Inc, Braintree, Mass). Mouse temperature was monitored by rectal probe and maintained at 37°C through automated warming using a controlled warming pad (ATCC 2000 ...
-
No products found
because this supplier's products are not listed.
Alexandra Maslennikova, et al.,
bioRxiv - Microbiology 2021
Quote:
The levels of HIV-1 core protein Gag in cell supernatants were quantified using HIV-1 p24 ELISA Kit (Zeptometrix, Bufalo NY, USA) in accordance to the manufacturer’s instruction ...
-
No products found
because this supplier's products are not listed.
Haeyoung Kim, et al.,
bioRxiv - Cell Biology 2022
Quote:
... rat-anti RFP (1:500 dilution) (Bulldog Bio Inc, #RMA5F8) for over-night at 4°C ...
-
No products found
because this supplier's products are not listed.
Travis C. Glenn, et al.,
bioRxiv - Genomics 2019
Quote:
... Protocol 1: EZNA Tissue DNA KIT (Omega Bio-Tek, USA); Protocol 2 ...
-
No products found
because this supplier's products are not listed.
Taylor Anthony Stevens, et al.,
bioRxiv - Biochemistry 2023
Quote:
... vented cap (1 L roller bottle; Celltreat, cat. no. 229383)
-
No products found
because this supplier's products are not listed.
Hiroshi Yamaguchi, et al.,
bioRxiv - Cell Biology 2022
Quote:
... Methylated gold nanoparticles (final 1:2 dilution; CGM2K-15-25, Cytodiagnostics) were added as fiducial markers ...
-
No products found
because this supplier's products are not listed.
Caroline Murawski, et al.,
bioRxiv - Neuroscience 2020
Quote:
... and 2 µm S1818 (Microchem, 5000 rpm, baking at 100°C for 1 min). Patterns were developed for 40 – 50 s in MF319 (Microchem) ...