-
No products found
because this supplier's products are not listed.
Yuichi Shichino, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... and then incubated with 150 μl of FLAG elution buffer (FLAG wash buffer 2 with 1 mg/ml 3×FLAG peptide [Protein Ark, GEN-3XFLAG-25]) overnight ...
-
No products found
because this supplier's products are not listed.
Qingxia Zhao, et al.,
bioRxiv - Immunology 2021
Quote:
... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.
-
No products found
because this supplier's products are not listed.
Colton D. Payne, et al.,
bioRxiv - Biochemistry 2020
Quote:
... The resin used as an anchor for peptide assembly was Tentagel XV 4-hydroxymethyl phenoxyacetic acid (Rapp Polymere, GmbH). Prior to the loading of the C-terminal residue ...
-
No products found
because this supplier's products are not listed.
Vera Vysochinskaya, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... or to 5 µL peptide/liposome complexes with siRNA and applied to a freshly cleaved mica (SPI Supplies, West Chester, PA, USA). The mixture was then incubated at room temperature for 1 minute ...
-
No products found
because this supplier's products are not listed.
Suk Woo Kang, et al.,
bioRxiv - Biochemistry 2022
Quote:
... 1-cyclohexene-1-carboxylic acid (16a) and methyl-1-cyclohexene-1-carboxylate (17a) were provided by Enamine (Kiev, Ukraine). trans-myrtanol was purchased from abcr GmbH (Karlsruhe ...
-
No products found
because this supplier's products are not listed.
Lesia Rodriguez, et al.,
bioRxiv - Plant Biology 2022
Quote:
... affinity-purified TMK1 (1:1000, 59), AHA2 (1:1000, 73) and PIN2 (1:1000, 35) antibodies and anti-ROP6 (C) (1:1000, Abiocode), using anti-Rabbit HRP-conjugated (1:5000 ...
-
No products found
because this supplier's products are not listed.
Teodor E. Yordanov, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Sodium Hyaluronate (1-1.8MDa) (Lifecore Biomedical; HA15M-1), Hyaluronidase from Streptomyces hyalurolyticus (Sigma Aldrich ...
-
No products found
because this supplier's products are not listed.
Manami Suzuki-Karasaki, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... 1 μM OxiOrangeTM or 1 μM HydropTM (Goryo Chemicals, Sapporo, Japan) for 20 min ...
-
No products found
because this supplier's products are not listed.
Charlie J. Childs, et al.,
bioRxiv - Bioengineering 2023
Quote:
... Human Fibrinogen 1 Plasminogen Depleted (Enzyme Research Lab Cat#FIB-1), and X-Vivo 20 (Lonza Cat#190995) ...
-
No products found
because this supplier's products are not listed.
Maxwell P. Bui-Marinos, et al.,
bioRxiv - Immunology 2021
Quote:
... and RNA quality was examined by electrophoresing 1 μg of RNA on a 1% agarose gel containing 1% bleach (Aranda et al., 2012) and 1 × RedSafe nucleic acid staining solution (FroggaBio) in 1 × TAE buffer at 100 V for 35 min ...
-
No products found
because this supplier's products are not listed.
Wenzhi Feng, et al.,
bioRxiv - Cell Biology 2021
Quote:
... polyclonal anti-Hexokinase 1 rabbit IgG (United States Biological, 169073, 1:10000), polyclonal anti-NDT80 rabbit IgG (1:10000) ...
-
No products found
because this supplier's products are not listed.
Geoffrey L. Rogers, et al.,
bioRxiv - Immunology 2023
Quote:
... 1 µg of His-tagged HIV-1 JR-CSF gp120 (Immune Technology) was added to cells for 15 min at room temperature ...
-
No products found
because this supplier's products are not listed.
Giorgio Anselmi, et al.,
bioRxiv - Immunology 2019
Quote:
... 1% BSA (Apollo Scientific) and 2 mM EDTA (Life Technologies) ...
-
No products found
because this supplier's products are not listed.
Görkem Garipler, et al.,
bioRxiv - Developmental Biology 2020
Quote:
... 1 mM DSG (ProteoChem) was used for crosslinking at RT for 15min ...
-
No products found
because this supplier's products are not listed.
Ewan Phillip Ramsay, et al.,
bioRxiv - Biochemistry 2020
Quote:
HeLa cells were transfected with a 1:1:1 mix of gRNA1 and gRNA2 vectors together with the donor plasmid using PolyJet transfection reagent (SL100688, SignaGen Laboratories) according to the manufacturer’s instructions ...
-
magnetofection
difficult to transfect cells
Cat# KC30296,
PolyMag 100µL+PolyMag Neo100µL+ CombiMag 100µL+Magnetic Plate MF96000, USD $640.63/KIT
Ask
Andrew S. Flies, et al.,
bioRxiv - Immunology 2020
Quote:
... Digested proteins in PBS were diluted 1:1 in Squalvax (Oz Biosciences # SQ0010) to a final concentration of 0.1 μg/μL and was mixed using interlocked syringes to form an emulsion ...
-
No products found
because this supplier's products are not listed.
Sangeeta Ghuwalewala, et al.,
bioRxiv - Developmental Biology 2022
Quote:
... Mice were fed with doxy chow (1 g doxy/1 kg, Bio-serv) for the indicated chase periods ...
-
No products found
because this supplier's products are not listed.
Piotr T. Wysocki, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... and MCDB-105 (Cell Applications, San Diego, CA, USA; ratio 2:1:1). Culture media were supplemented with 10% fetal bovine serum (FBS ...
-
No products found
because this supplier's products are not listed.
Rudolf O. Schlechter, et al.,
bioRxiv - Microbiology 2023
Quote:
... gas permeability of 0.6 m3 m−2 day−1 and water loss of 1 g m−2 day−1; Brooks Life Sciences, UK), and incubated at 30°C with shaking ...
-
SPARC Blocking Peptide is a blocking peptide which can be used to block the reactivity of the...
Cat# abx064210-1MG,
1 mg USD $232.0
Ask
Lauranne Drelich, et al.,
bioRxiv - Cancer Biology 2020
Quote:
... MAOB (Abbexa; 1/100 dilution), IGHM (Abcam ...
-
No products found
because this supplier's products are not listed.
Kristina Thamm, et al.,
bioRxiv - Cell Biology 2021
Quote:
... The digest was diluted 1:1 with CnT-PR-MSC-XF-HC (CELLnTEC, Bern, Switzerland), a chemically defined ...
-
Native Antigen
Cat# NAT41587-100,
100µg USD $426.0
Ask
Emanuele Andreano, et al.,
bioRxiv - Immunology 2020
Quote:
... were coated with 25 μl/well of antigen (1:1 mix of S1 and S2 subunits, 1 μg/ml each; The Native Antigen Company, Oxford, United Kingdom) diluted in coating buffer (0.05 M carbonate-bicarbonate solution ...
-
No products found
because this supplier's products are not listed.
Andreas Damianou, et al.,
bioRxiv - Microbiology 2020
Quote:
... 20 μl mL−1 proteoloc (Expedeon), 0.17 complete protease inhibitor tablets mL−1 (Sigma) ...
-
No products found
because this supplier's products are not listed.
Matthew A. Jorgenson, Joseph C. Bryant,
bioRxiv - Microbiology 2020
Quote:
Cells were cultured in LB Miller broth (1% tryptone, 0.5% yeast extract, and 1% NaCl; IBI Scientific) or λYM broth (1% tryptone ...
-
No products found
because this supplier's products are not listed.
Andrew J. Stout, et al.,
bioRxiv - Bioengineering 2021
Quote:
... 10ng/mL insulin-like growth factor 1 (IGF-1; Shenandoah Biotechnology #100-34AF-100UG, Warminster, PA, USA) and 10 ng/mL epidermal growth factor (EGF ...
-
No products found
because this supplier's products are not listed.
Carla Merino, et al.,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
4-(Methylnitrosamino)-1-(3-pyridyl)-1-butanone (NNK) was obtained from LGC-Dr Ehrenstorfer (LGC Standards, Barcelona, Spain) and 4-Hydroxy-4-(3-pyridyl)-butyric acid (HPBA ...
-
No products found
because this supplier's products are not listed.
Daniel Chen, et al.,
bioRxiv - Neuroscience 2024
Quote:
Motor neurons were dissociated using a 1:1 dissociation solution of Accutase and Accumax (Innovative Cell Technologies Inc.) were counted using Trypan Blue to ensure a survival rate above 80% ...
-
No products found
because this supplier's products are not listed.
Aviad Ben-Shmuel, et al.,
bioRxiv - Immunology 2021
Quote:
... Rabbit anti-pSHP-1 (S591) (ECM Biosciences), Rabbit anti-pPLCγ1 (Y783 ...
-
No products found
because this supplier's products are not listed.
Linglei Jiang, et al.,
bioRxiv - Immunology 2022
Quote:
... IgA (1:250, Brookwood Biomedical, AL, USA) or IgM (1:250 ...
-
No products found
because this supplier's products are not listed.
Xin Lai, et al.,
bioRxiv - Systems Biology 2020
Quote:
... 1 000 U/mL IL-6 (CellGenix), 10 ng/mL TNF (Beromun ...
-
No products found
because this supplier's products are not listed.
Celine Everaert, et al.,
bioRxiv - Molecular Biology 2019
Quote:
... and 1 µl reaction buffer (ArcticZymes 66001). Of the resulting volume ...
-
No products found
because this supplier's products are not listed.
Antje Neeb, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... panBAG-1 (human, rabbit monoclonal, RM356, RevMAb), panBAG-1 (mouse ...
-
No products found
because this supplier's products are not listed.
P Whyte-Fagundes, et al.,
bioRxiv - Neuroscience 2023
Quote:
... AA43279 (Focus biomolecules, CAS: 354812-16-1), Chlorzoxazone (Sigma Aldrich ...
-
No products found
because this supplier's products are not listed.
Yikun Xing, et al.,
bioRxiv - Microbiology 2023
Quote:
... The organs were homogenized in 1 ml 1× PBS using a BeadBlaster Refrigerated Homogenizer (Benchmark Scientific Inc, Sayreville, NJ, USA), and the organ homogenates were plated on LB agar plates and incubated at 37L to determine the number of bacteria or colony-forming units (CFU ...
-
No products found
because this supplier's products are not listed.
Caitlin P. Mencio, et al.,
bioRxiv - Cell Biology 2022
Quote:
... 1 mU heparinase III (Seikagaku Corp., Tokyo, Japan), 31.3 mM sodium acetate ...
-
No products found
because this supplier's products are not listed.
Serena R.G. Page, et al.,
bioRxiv - Plant Biology 2020
Quote:
... 1 mL/L of B5 vitamins (Phytotechnology Laboratories), and 0.5 μM TDZ (Fisher Scientific ...
-
No products found
because this supplier's products are not listed.
Maximiliano José Nigro, et al.,
bioRxiv - Neuroscience 2022
Quote:
... Rabbit IgG anti-SST (1:1000, BMA Biomedicals), Rabbit IgG anti-VIP (1:1000 ...
-
No products found
because this supplier's products are not listed.
Philip Kawalec, et al.,
bioRxiv - Physiology 2022
Quote:
... Serum Troponin-I was measured using the Ultra-Sensitive Mouse Cardiac Troponin-I ELISA Kit purchased from Life Diagnostics (CTNI-1-US; Life Diagnostics; West Chester, PA).
-
LyP-1 is a cyclic cryptic CendR peptide and selectively binds to p32 receptors overexpressed in...
Cat# BAT-010008,
Inquire
Ask
Ana C. Puhl, et al.,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
Pyronaridine tetraphosphate [4-[(7-Chloro-2-methoxybenzo[b][1,5]naphthyridin-10-yl)amino]-2,6-bis(1-pyrrolidinylmethyl)phenol phosphate (1:4)] (12) was purchased from BOC Sciences (Shirley NY). The purity of this compound was greater than 95% ...
-
No products found
because this supplier's products are not listed.
Francesco Pesce, et al.,
bioRxiv - Biophysics 2022
Quote:
... 1 mM DTT) and cells lysed by 1 cycle of French Press at 25 kPsi (Constant Systems Ltd MC Cell Disrupter). The lysate was centrifuged at 4 °C and 20000 g for 30 min and the supernatant applied to a gravity flow column with 4 mL pre-equilibrated Ni-NTA Sepharose resin (GE Healthcare) ...
-
No products found
because this supplier's products are not listed.
Jessica B. Sarthi, et al.,
bioRxiv - Physiology 2023
Quote:
... Mice were anesthetized with oxygen-delivered isoflurane (1-3%) at 1 L/min via a vaporizer (Braintree Scientific, Inc, Braintree, Mass). Mouse temperature was monitored by rectal probe and maintained at 37°C through automated warming using a controlled warming pad (ATCC 2000 ...
-
No products found
because this supplier's products are not listed.
Laura Virtanen, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... rat monoclonal HSF1 (1:400, 10H8, StressMarq Bioscience Inc.), rabbit monoclonal Lap2α (1:1000 ...
-
No products found
because this supplier's products are not listed.
Alexandra Maslennikova, et al.,
bioRxiv - Microbiology 2021
Quote:
The levels of HIV-1 core protein Gag in cell supernatants were quantified using HIV-1 p24 ELISA Kit (Zeptometrix, Bufalo NY, USA) in accordance to the manufacturer’s instruction ...
-
No products found
because this supplier's products are not listed.
Kelly S. Ireland, Kathryn Milligan-Myhre,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
... tissues from three individuals from the same tank were added to 200 µl Trizol with a 1:1 mix of 0.5 and 1.0 mm zirconia oxide beads in a RINO tube (Next Advance Inc. Troy, NY, USA), flash-frozen using liquid nitrogen ...
-
No products found
because this supplier's products are not listed.
Haeyoung Kim, et al.,
bioRxiv - Cell Biology 2022
Quote:
... rat-anti RFP (1:500 dilution) (Bulldog Bio Inc, #RMA5F8) for over-night at 4°C ...
-
No products found
because this supplier's products are not listed.
Travis C. Glenn, et al.,
bioRxiv - Genomics 2019
Quote:
... Protocol 1: EZNA Tissue DNA KIT (Omega Bio-Tek, USA); Protocol 2 ...
-
No products found
because this supplier's products are not listed.
Taylor Anthony Stevens, et al.,
bioRxiv - Biochemistry 2023
Quote:
... vented cap (1 L roller bottle; Celltreat, cat. no. 229383)
-
No products found
because this supplier's products are not listed.
Hiroshi Yamaguchi, et al.,
bioRxiv - Cell Biology 2022
Quote:
... Methylated gold nanoparticles (final 1:2 dilution; CGM2K-15-25, Cytodiagnostics) were added as fiducial markers ...
-
No products found
because this supplier's products are not listed.
Minchen Chien, et al.,
bioRxiv - Pharmacology and Toxicology 2020
Quote:
... and then used to infect 1 L of Sf21 cells (Expression Systems) and incubated for 48 hrs at 27°C ...
-
No products found
because this supplier's products are not listed.
Caroline Murawski, et al.,
bioRxiv - Neuroscience 2020
Quote:
... and 2 µm S1818 (Microchem, 5000 rpm, baking at 100°C for 1 min). Patterns were developed for 40 – 50 s in MF319 (Microchem) ...