-
No products found
because this supplier's products are not listed.
Naushin L. Hindul, et al.,
bioRxiv - Cell Biology 2023
Quote:
... The starved cells were growth-factor stimulated with fresh DMEM media containing 100ng/ml epidermal growth factor (EGF Human #A63411-500 (Antibodies.com)) ...
-
Cat# AG321-1,
USD $65.0/100.0ml
Ask
Akihisa Kato, et al.,
bioRxiv - Microbiology 2023
Quote:
... glycoprotein B (gB) (H1817; Virusys), Flag (M2 ...
-
No products found
because this supplier's products are not listed.
Lawrence G. Welch, et al.,
bioRxiv - Cell Biology 2024
Quote:
... CD19+ B-cells (HemaCare, US) were cultured in B cell Excellerate medium with the CEllXVivo B cell expansion kit (R&D systems ...
-
No products found
because this supplier's products are not listed.
Nadja I. Lorenz, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... 20 ng/ml epidermal growth factor (EGF) and 20 ng/ml human recombinant basic fibroblast growth factor (bFGF) (ReliaTech, Wolfenbüttel, Germany).
-
No products found
because this supplier's products are not listed.
Eric Waltari, et al.,
bioRxiv - Immunology 2019
Quote:
... Blocking solution (sciBLOCK Protein D1M solution, Scienion) was added at 200 μL/well with a multichannel pipet and allowed to incubate without agitation for 1 hour ...
-
No products found
because this supplier's products are not listed.
Ly Porosk, et al.,
bioRxiv - Biochemistry 2022
Quote:
... Peptide-based transfection reagent Reagent007 from Icosagen suitable for suspension cells ...
-
No products found
because this supplier's products are not listed.
Marcus Deichmann, et al.,
bioRxiv - Synthetic Biology 2023
Quote:
... a Jurkat cell line equipped with a nuclear factor of activated T cell (NFAT) transcription factor luciferase reporter system (Jurkat NFAT-Luc) (Nordic BioSite, Cat.#BPS-60621) was further modified by insertion of an anti-CD19 CAR (FMC63-CD8ɑ-4-1BB-CD3ζ ...
-
No products found
because this supplier's products are not listed.
Fabrizio Clarelli, et al.,
bioRxiv - Biochemistry 2019
Quote:
... GyrB (Rabbit α-Gyrase B, PB005, Inspiralis), and CRP (Mouse α-E ...
-
Cat# GC10002,
5x Lysis Buffer 55ml
Standard Dilution Buffer 55ml
10X CPRG Substrate Stock Solution 5ml
Substrate Buffer 55ml
Stop Buffer 55ml
β-gal enzyme100µl, USD $241.00/KIT
Ask
Zeyang Shen, et al.,
bioRxiv - Genomics 2021
Quote:
... 2.5 μl/ml lentiblast B (OZ Biosciences) and 8 μg/ml polybrene (Sigma-Aldrich ...
-
B-factor is extracted from yeast.
Cat# BBF-00141,
Inquire
Ask
Minjoo Kim, et al.,
bioRxiv - Biochemistry 2019
Quote:
... The resulting whole cell lysate was then tumbled with N,N-dimethyl-N-dodecylglycine (Empigen BB Detergent, BOC Sciences) (3% v/v ...
-
No products found
because this supplier's products are not listed.
Rick G. Kim, et al.,
bioRxiv - Plant Biology 2024
Quote:
... Biotinylated peptides were searched using exogenous biotin (ExBio) on lysine as a variable modification ...
-
No products found
because this supplier's products are not listed.
László Imre, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Cyclodextrin/peptide complex formation was performed by mixing 30 μM peptide and 300 μM SBECD (Sulfobutylether-β-Cyclodextrin; CycloLab, Budapest, Hungary) diluted in colorless ...
-
No products found
because this supplier's products are not listed.
Camilla Schinner, et al.,
bioRxiv - Cell Biology 2021
Quote:
... with 2x gentamicin/amphotericin B (CELLnTEC, Bern, Switzerland) over night at 4 °C ...
-
No products found
because this supplier's products are not listed.
Elena Porcellato, et al.,
bioRxiv - Biochemistry 2021
Quote:
... Solvent B was composed of 0.1% FA (ProteoChem), 10% H2O (Biosolve ...
-
No products found
because this supplier's products are not listed.
Dessislava Malinova, et al.,
bioRxiv - Immunology 2020
Quote:
... B cells were incubated with microbeads (Bangs laboratories) conjugated to anti-Igκ and Ea-peptide (Biotin-GSGFAKFASFEAQGALANIAVDKA-COOH ...
-
No products found
because this supplier's products are not listed.
Kamyab Javanmardi, et al.,
bioRxiv - Biochemistry 2021
Quote:
... Membranes were blocked in LICOR Odyssey Blocking Buffer (Neta Scientific) incubated with the following primary antibodies overnight ...
-
No products found
because this supplier's products are not listed.
Jinge Gu, et al.,
bioRxiv - Cell Biology 2020
Quote:
... mouse anti-Hsp70 (StressMarq Biosciences Inc, SMC-100A/B), mouse anti-GAPDH (Proteintech ...
-
No products found
because this supplier's products are not listed.
Aadra P. Bhatt, et al.,
bioRxiv - Microbiology 2024
Quote:
... lamblia (assemblage B, H3 cysts) were acquired from Waterborne, Inc and as previously described9 ...
-
Atrial Natriuretic Peptide ( ANP ) ELISA / Assay Kit
Cat# K071-H1,
1.0 ea, USD $385.0
Ask
Soon Yew Tang, et al.,
bioRxiv - Pharmacology and Toxicology 2020
Quote:
Atrial natriuretic peptide (Arbor Assays, K026-H1, Ann Arbor, MI), total nitrate+nitrite (Cayman Chemical ...
-
No products found
because this supplier's products are not listed.
Christopher J. Fitzpatrick, et al.,
bioRxiv - Animal Behavior and Cognition 2019
Quote:
... and fibroblast growth factor 2 (FGF2; #45103P; QED Bioscience, Inc.; San Diego, CA) were used ...
-
No products found
because this supplier's products are not listed.
Mario Vitacolonna, et al.,
bioRxiv - Cancer Biology 2024
Quote:
... B: BRANDplates® 96-well microtitration plate (BrandTech Scientific, #781900), C ...
-
No products found
because this supplier's products are not listed.
Sonja Giger, et al.,
bioRxiv - Bioengineering 2021
Quote:
... recombinant human epidermal growth factor (hEGF, 20 ng/ml, Chimerigen Laboratories, CHI-HF-210EGF), recombinant human platelet derived growth factor (hPDGF-AB ...
-
No products found
because this supplier's products are not listed.
Belinda Liu, et al.,
bioRxiv - Biochemistry 2019
Quote:
... or the insulin receptor signal peptide were synthesized by Eton Biosciences. Similarly ...
-
No products found
because this supplier's products are not listed.
Francesco Caiazza, et al.,
bioRxiv - Cancer Biology 2019
Quote:
... and peptides desalted with C18 Desalting Tips (Rainin, Oakland, CA, USA), lyophilized ...
-
No products found
because this supplier's products are not listed.
Riley A. Suhar, et al.,
bioRxiv - Bioengineering 2021
Quote:
... for HA-B or Ald- CH2-PEG3-Azide (BroadPharm, BP-21715) for HA-A in extra-dry DMSO (100 mg mL-1 ...
-
No products found
because this supplier's products are not listed.
Ivan Vujkovic-Cvijin, et al.,
bioRxiv - Immunology 2021
Quote:
... Resulting suspensions were plated on YCFAC+B (Anaerobe Systems, #AS-677), MTGE (Anaerobe Systems ...
-
No products found
because this supplier's products are not listed.
Joshua Johnson, et al.,
bioRxiv - Physiology 2020
Quote:
... Endogenous peroxidase blocking was performed by using 3% hydrogen peroxide (Labchem, Cat # LC154301). Sections were then washed in water ...
-
No products found
because this supplier's products are not listed.
Yu Xin Wang, et al.,
bioRxiv - Cell Biology 2022
Quote:
... sera were thawed on ice and IgM Rheumatoid Factor Mouse ELISA (BioVendor; cat 634-02689) was performed according to manufacturer’s instructions.
-
No products found
because this supplier's products are not listed.
Robert Horvath, et al.,
bioRxiv - Evolutionary Biology 2023
Quote:
We identified TE polymorphisms significantly associated with environmental factors using genome-environment association analyses (GEA) following Minadakis et al ...
-
No products found
because this supplier's products are not listed.
Marie-Claire Dagher, et al.,
bioRxiv - Bioengineering 2022
Quote:
... Thrombin generation was triggered by 1pM tissue factor and 4μM phospholipids (PPP-reagent low, Diagnostica Stago) in the presence of a fluorogenic substrate (FluCa kit) ...
-
The peptide is used to block Anti-Factor B Bb Antibody (#CPA3501) reactivity.
Cat# CBP3501,
1 mg USD $100.0, 5 mg USD $300.0
Ask
Rafał Zdrzałek, et al.,
bioRxiv - Plant Biology 2024
Quote:
... membranes were incubated with appropriate antibodies diluted in blocking buffer (α-FLAG: Cohesion Biosciences, at 1:3000 dilution ...
-
No products found
because this supplier's products are not listed.
Emma Hajaj, et al.,
bioRxiv - Physiology 2019
Quote:
... intracellular granzyme-B was labeled with anti-GzmB antibody (Biogems, clone: NGZB) for 30 min at RT ...
-
No products found
because this supplier's products are not listed.
Marisa Oliveira, et al.,
bioRxiv - Immunology 2020
Quote:
... P/S and 25 ng/ml recombinant chicken colony stimulating factor 1 (CSF-1) (Kingfisher Biotech, Inc) at 41 °C and 5% CO2 ...
-
No products found
because this supplier's products are not listed.
Logan S. Richards, et al.,
bioRxiv - Biochemistry 2021
Quote:
... The peptide crystals were harvested from hanging drops using CryoLoops™ from Hampton Research with no additional cryoprotectant other than the MPD already present and flash-frozen in liquid nitrogen ...
-
No products found
because this supplier's products are not listed.
Sebastian P.H. Speer, et al.,
bioRxiv - Neuroscience 2020
Quote:
... b) the BisBas scale to assess dispositional inhibition and approach behavior (Carver & White, 1994), c ...
-
No products found
because this supplier's products are not listed.
Qingxia Zhao, et al.,
bioRxiv - Immunology 2021
Quote:
... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.
-
No products found
because this supplier's products are not listed.
Cellas A. Hayes, et al.,
bioRxiv - Neuroscience 2021
Quote:
... cells were grown on a T-75 flasks pre-coated with Cell Attachment Factor Solution (123-100, Cell Applications), in 15mL of RBMVEC growth medium (R819-500) ...
-
No products found
because this supplier's products are not listed.
Jonathan Pansieri, et al.,
bioRxiv - Biophysics 2020
Quote:
... Aβ42 fibrils were prepared by incubating 100 μM Aβ42 peptide in phosphate buffer saline (PBS, Medicago) at pH 7.4 and 42°C ...
-
No products found
because this supplier's products are not listed.
The Nhu Nguyen, et al.,
bioRxiv - Microbiology 2023
Quote:
Antibody responses against IAV-S nucleoprotein (NP) were measured by using a commercial blocking ELISA (IDEXX, Montpellier, France), following the manufacturer’s recommendation ...
-
No products found
because this supplier's products are not listed.
Wren E. Michaels, et al.,
bioRxiv - Cell Biology 2021
Quote:
... Quantitative analysis of the CFTR B and C-bands was performed using Compass software (Protein Simple).
-
No products found
because this supplier's products are not listed.
Nikolas Nikolaou, et al.,
bioRxiv - Neuroscience 2020
Quote:
... This was removed and coverslips were incubated with fresh blocking solution containing anti-GFP 1:1000 (Torrey Pines Biolabs-TP401) and anti-SNRNP70 1:200 (Sigma-AV40276 ...
-
No products found
because this supplier's products are not listed.
Vilma Väänänen, et al.,
bioRxiv - Developmental Biology 2023
Quote:
... Equal amounts of solutions A (Enhancer) and B (Activator) of the kit (GoldEnhance for LM, 2112-28ML, Nanoprobes) were mixed and left to incubate for 10 minutes before addition of solutions C (Initiator) ...
-
No products found
because this supplier's products are not listed.
Colton D. Payne, et al.,
bioRxiv - Biochemistry 2020
Quote:
... The resin used as an anchor for peptide assembly was Tentagel XV 4-hydroxymethyl phenoxyacetic acid (Rapp Polymere, GmbH). Prior to the loading of the C-terminal residue ...
-
No products found
because this supplier's products are not listed.
Takafumi Kato, et al.,
bioRxiv - Pathology 2021
Quote:
... PRR4 cDNA without a signal peptide sequence (corresponding to amino acids 17 to 134) was cloned into the pM-secSUMOstar Vector (7121, LifeSensors). SUMOstar-PRR4 vectors were transfected into Expi293 cells (1 mg of DNA per liter of transfection ...
-
No products found
because this supplier's products are not listed.
Toshiharu Ichinose, et al.,
bioRxiv - Neuroscience 2024
Quote:
... The ribosome-bound mRNA was eluted with 50 µl of 100 µg/ml 3× FLAG peptide (GEN-3XFLAG- 25, Protein Ark) dissolved in the lysis buffer.
-
No products found
because this supplier's products are not listed.
Amit Rahi, et al.,
bioRxiv - Cell Biology 2022
Quote:
... followed by incubation for 5 min and intermittent washing with 3 chamber volumes of buffer B: PLL PEG biotin (0.1 mg ml-1, Susos, AG), Streptavidin (0.625 mg ml-1 ...
-
No products found
because this supplier's products are not listed.
Tiesuo Zhao, et al.,
bioRxiv - Immunology 2024
Quote:
The tissue samples were incubated with primary antibodies (CD3, 1:100, OmnimAbs; CD4, 1:200, CST; CD8, 1:800, CST; Granzyme B, 1:200, Bioworld; CD86 ...
-
No products found
because this supplier's products are not listed.
Timothy Chaya, et al.,
bioRxiv - Plant Biology 2023
Quote:
... Samples were imaged using Borealis Total Internal Reflection Microscopy (B-TIRF) or Spinning disk on an Andor Dragonfly 600 microscope (Oxford Instruments) with a Zyla sCMOS camera and a Leica Plan Apo 63x/1.47 NA oil TIRF objective ...
-
No products found
because this supplier's products are not listed.
Brian J. Sanderson, et al.,
bioRxiv - Evolutionary Biology 2019
Quote:
... All seeds were sown on autoclaved Gamborg’s B-5 Basal Salts (without sucrose) and Phytoblend agar (Caisson Laboratories, Inc., Smithfield, Utah, USA) and poured into sterilized petri dishes ...
-
No products found
because this supplier's products are not listed.
Ludivine Pidoux, et al.,
bioRxiv - Neuroscience 2020
Quote:
... and/or 5 consecutive pinches, using either calibrated forceps (300g stimulations, Bioseb, France) or classical forceps (Moria MC40/B, Fine Science Tools, Germany) for rats and mice ...