-
No products found
because this supplier's products are not listed.
Katrin Manske, et al.,
bioRxiv - Bioengineering 2023
Quote:
... Target cell death was measured by impedance-based xCELLigence RTCA System (ACEA Biosciences).
-
No products found
because this supplier's products are not listed.
Michelle Wintzinger, et al.,
bioRxiv - Physiology 2022
Quote:
... we followed general guidelines associated with the staining assay #KTMTR2LT (StatLab; McKinney, TX). Briefly ...
-
No products found
because this supplier's products are not listed.
Chrysa Koukorava, et al.,
bioRxiv - Cell Biology 2023
Quote:
... All primary mouse cells and associated media were purchased from Cell Biologics (USA).
-
No products found
because this supplier's products are not listed.
Hritika Sharma, Anjali Bose, Uma Kumar, Rahul Pal,
bioRxiv - Immunology 2020
Quote:
... reactivity towards lupus-associated autoantigens (dsDNA, Sm, RNP 68K, Ro60, La; Arotec Diagnostics Limited), as well as towards murine ferrous Hb and murine ferric Hb ...
-
No products found
because this supplier's products are not listed.
Robert G. Orr, et al.,
bioRxiv - Plant Biology 2020
Quote:
... as our results were all obtained using a single lot of 2-FA from Oakwood Chemical, SC ...
-
No products found
because this supplier's products are not listed.
Mona Abed, et al.,
bioRxiv - Molecular Biology 2019
Quote:
... in buffer A (2% ACN/0.1% FA) on 100 µm ID PicoFrit column packed with 1.7 µm Acquity BEH (New Objective) at a flow rate of 450 nL/min ...
-
No products found
because this supplier's products are not listed.
Alexander Demoor, et al.,
bioRxiv - Genetics 2022
Quote:
... Germany), with 4 lasers (405nm, 488nm, 561nm, 640nm) for fluorescence observations and their associated filters and a sCMOS PRIME95 (Photometrics) camera at the Imagoseine Imaging Facility ...
-
No products found
because this supplier's products are not listed.
K. Rosenke, et al.,
bioRxiv - Microbiology 2021
Quote:
... Coagulation values were determined from citrated plasma utilizing a STart4 Hemostatis Analyzer and associated testing kits (Diagnostica Stago, Parsippany, NJ, USA).
-
No products found
because this supplier's products are not listed.
Quentin Sabbagh, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... 4°C) by size exclusion chromatography (SEC) using 70 nm Original qEV columns associated with an automatic fraction collector (Izon Science), according to the manufacturer’s protocol and recommendations from the International Society for Extracellular Vesicles (ISEV ...
-
No products found
because this supplier's products are not listed.
Arja Ray, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... from human patients were obtained as formalin-fixed paraffin-embedded (FFPE) sections in the form of a tissue with associated pathology information (Staging, grading etc.; US Biomax, Inc). In addition ...
-
No products found
because this supplier's products are not listed.
MR Melo, et al.,
bioRxiv - Neuroscience 2022
Quote:
... followed by 4% formaldehyde (FA) in 0.1 M PBS using a peristaltic pump (Masterflex L/S Drive System, Cole-Parmer, Vernon Hills, Illinois, USA). The brains were removed ...
-
No products found
because this supplier's products are not listed.
Shiying Liu, Yue Meng, Pakorn Kanchanawong,
bioRxiv - Cell Biology 2023
Quote:
... The truncated mutants including E-cadherin-mScarlet-I ΔEC (removing extracellular domain 157-709 amino acids) and E-cadherin-mScarlet-I ΔIC (removing intracellular domain 733-884 amino acids) were synthesised by Epoch Life Science, Inc.
-
No products found
because this supplier's products are not listed.
Zhaoqian Wang, et al.,
bioRxiv - Biochemistry 2023
Quote:
... domain of LayV F (LayV HR2, KIDIGNQLAGINQTLQNAEDYIEKSEEFLKGINPSI) and the corresponding scrambled peptide (scrambled LayV HR2, SIANIQEKDIIKLETEDPEIYAGNKLGSQILNFGQN) were synthesized by Biosynth (Gardner, MA, USA).
-
No products found
because this supplier's products are not listed.
A. Rahman, et al.,
bioRxiv - Immunology 2019
Quote:
... Lysates (containing protein at 6mg/mL) from four donors were pooled prior to Kinex antibody microarray analysis (Kinexus Bioinformatics) (H ...
-
No products found
because this supplier's products are not listed.
Amanda P. Waller, et al.,
bioRxiv - Pathology 2020
Quote:
... ELISA and immunoblot antibodies were validated using species-specific positive (purified species-specific protein; Haematologic Technologies, Inc, Essex Juntion, VT) and non-specific protein negative controls ...
-
No products found
because this supplier's products are not listed.
Alexander W. Justin, et al.,
bioRxiv - Bioengineering 2022
Quote:
... Green fluorescent protein (GFP) and Red Fluorescent Protein (RFP) human umbilical vein endothelial cells (HUVECs, Promocell), normal human lung fibroblasts (NHLFs ...
-
No products found
because this supplier's products are not listed.
Eric Waltari, et al.,
bioRxiv - Immunology 2019
Quote:
... Blocking solution (sciBLOCK Protein D1M solution, Scienion) was added at 200 μL/well with a multichannel pipet and allowed to incubate without agitation for 1 hour ...
-
No products found
because this supplier's products are not listed.
Paulus Mrass, et al.,
bioRxiv - Immunology 2022
Quote:
... We used the following antibodies: H3N2 virion antibody (ViroStat, Cat#: 1317); anti-mouse CD107A ...
-
No products found
because this supplier's products are not listed.
Hongmei Qiao, et al.,
bioRxiv - Genomics 2020
Quote:
... AFP4/TMAC2 (ABI FIVE BINDING PROTEIN 4, AT3G02140), DOG1 (AT5G45830 ...
-
No products found
because this supplier's products are not listed.
Delia Onorini, et al.,
bioRxiv - Microbiology 2022
Quote:
... The primary antibody used was a Chlamydiaceae family-specific rabbit polyclonal antibody LPS/MOMP antibody (Cygnus Technologies, Inc., Southport, NC, USA) at a 1:1000 dilution ...
-
No products found
because this supplier's products are not listed.
Verica Vasić, et al.,
bioRxiv - Neuroscience 2022
Quote:
... As primary antibody a polyclonal rabbit anti-human EGFL7 antibody (1:50, ReliaTech GmbH) was applied ...
-
No products found
because this supplier's products are not listed.
Silvia De Cicco, et al.,
bioRxiv - Neuroscience 2020
Quote:
... plus bone morphogenetic protein 4 (BMP4, 50 ng/mL, Immunotools), vascular endothelial growth factor (VEGF ...
-
No products found
because this supplier's products are not listed.
Adam J. Rauckhorst, et al.,
bioRxiv - Biochemistry 2023
Quote:
... 10 minutes and incubated with primary antibodies diluted in Normal Antibody Diluent (ScyTek Laboratories, ABB125) at 4°C overnight ...
-
No products found
because this supplier's products are not listed.
Annu Nummi, et al.,
bioRxiv - Cell Biology 2021
Quote:
... Secondary antibody was an HRP-polymer anti-rabbit antibody (BiositeHisto Nordic Biosite cat. no KDB-Z47C3W). Immunoreactivity of antibodies was controlled in sections of porcine kidney ...
-
No products found
because this supplier's products are not listed.
Cristina Márquez-López, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... Nsp1 proteins were performed in 35-mm tissue culture dishes (MatTek) using the jetPRIME® reagent according to the manufacturer’s protocol (Polyplus transfection®) ...
-
No products found
because this supplier's products are not listed.
Dennis S. Metselaar, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... glial fibrillary acidic protein (GFAP) (1:500; BT46-5002–04, BioTrend), S100 (1:1000 ...
-
No products found
because this supplier's products are not listed.
Avais M. Daulat, et al.,
bioRxiv - Cell Biology 2021
Quote:
... CLASP2 antibody was obtained from Absea Biotechnology ltd ...
-
No products found
because this supplier's products are not listed.
Alessandro Gori, et al.,
bioRxiv - Biochemistry 2023
Quote:
... The detector antibody (biotinylated CD9, CD63, CD81 antibodies by Ancell or anti-band 3 from Santa Cruz) solutions (0.3 µg/ml ...
-
No products found
because this supplier's products are not listed.
MaryAnn Martin, Irene L.G. Newton,
bioRxiv - Microbiology 2023
Quote:
Proteins were separated on 4-20% Tris-Glycine NB precast minigels (NuSep) and transferred to PVDF membrane in Tris-Glycine transfer buffer with 15% methanol at 40v on ice for 3 hours ...
-
No products found
because this supplier's products are not listed.
Gabriela O. Bodea, et al.,
bioRxiv - Genomics 2023
Quote:
... MeCP2: We quantified MeCP2 protein expression using Imaris 9.5.1 (Bitplane, Oxford Instruments and we analyzed two hippocampal sections per animal ...
-
No products found
Shaowen White, et al.,
bioRxiv - Cell Biology 2020
Quote:
... 1:500 mouse anti-VP5 antibody (Biodesign), or 1:250 chicken anti-UL34 antiserum (Reynolds et al. ...
-
No products found
because this supplier's products are not listed.
Prachiti Moghe, et al.,
bioRxiv - Developmental Biology 2023
Quote:
... Primary antibodies against NANOG (ReproCell, RCAB002P-F), PKCλ (Santa Cruz Biotechnology ...
-
No products found
because this supplier's products are not listed.
Aswini Panigrahi, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... Anti-Sulf-2 monoclonal antibodies (QED Bioscience), Anti-LG3BP monoclonal antibody (Proteintech) ...
-
No products found
because this supplier's products are not listed.
Antje Neeb, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... Lysate (600 μl) was incubated with 5 μg BAG-1L specific antibody rabbit monoclonal antibody (clone RM310; RevMAb Biosciences) at 4 °C for 16 hours to analyze the specificity of this antibody for its target ...
-
No products found
because this supplier's products are not listed.
Marijn Knip, Emy Latul, Frank LW Takken,
bioRxiv - Plant Biology 2023
Quote:
Proteins were isolated from six leaf discs (5mm Ø World Precision Instruments (WPI)) ...
-
No products found
because this supplier's products are not listed.
Fabian Braun, et al.,
bioRxiv - Molecular Biology 2019
Quote:
... was diluted with antibody diluent (Medac-diagnostica, Germany) 1:1000 and developed using poly-HRP-anti mouse/rabbit IgG (Bright Vision ...
-
No products found
because this supplier's products are not listed.
Derrick Lau, et al.,
bioRxiv - Biophysics 2019
Quote:
... and α-CA antibody (Advanced Biotechnologies, 13-102-100) and again rinsed with wash buffer (50 μL) ...
-
No products found
because this supplier's products are not listed.
Mihwa Choi, et al.,
bioRxiv - Neuroscience 2022
Quote:
... including antibodies against NET (Mab Technologies, 1:1000 dilution), cFos (Cell Signaling Technology ...
-
No products found
because this supplier's products are not listed.
Kei Sugihara, et al.,
bioRxiv - Cell Biology 2020
Quote:
... we used red fluorescent protein (RFP)-labeled HUVECs and GFP-labeled pericytes from Angio-proteomie Inc ...
-
No products found
because this supplier's products are not listed.
Paweł P. Knejski, et al.,
bioRxiv - Biochemistry 2023
Quote:
... purified proteins were diluted to 0.05 mg/mL and applied onto plasma-cleaned (Gatan Solarus) copper grids with a continuous carbon layer (Electron Microscopy Sciences) ...
-
No products found
because this supplier's products are not listed.
Megan E. Goeckel, et al.,
bioRxiv - Developmental Biology 2023
Quote:
The embryos were lysed and purified with DNA/RNA/Protein extraction kit (#IB47702, IBI Scientific) and then cDNA generated with SuperScript™ IV VILO™ Master Mix (#11766050 ...
-
No products found
because this supplier's products are not listed.
Roie Cohen, et al.,
bioRxiv - Developmental Biology 2022
Quote:
... Samples were then incubated overnight at 4°C in the appropriate primary antibody diluted in antibody diluent buffer (GBI labs cat: E09-300). Following 3 washes in PBS ...
-
No products found
because this supplier's products are not listed.
R Barbieri, et al.,
bioRxiv - Microbiology 2020
Quote:
... the paraffin sections were incubated with anti-glycophorin A antibody JC 159 (Mouse Monoclonal Antibody, ref: Mob 066-05, Diagnostic BioSystems, Nanterre, France) at a 1/500 dilution using a Ventana Benchmark autostainer (Ventana Medical Systems ...
-
No products found
because this supplier's products are not listed.
Han-Wei Shih, et al.,
bioRxiv - Developmental Biology 2022
Quote:
... Alexa 647-conjugated anti-CWP1 antibody (Waterborne, New Orleans, LA) was used at 1:2,000 ...
-
No products found
because this supplier's products are not listed.
Abdolhossein Zare, et al.,
bioRxiv - Neuroscience 2023
Quote:
... and motoneurons were enriched by p75NTR antibody (clone MLR2, Biosensis) panning ...
-
No products found
because this supplier's products are not listed.
Domagoj Cikes, et al.,
bioRxiv - Genetics 2023
Quote:
... Fifty ug of protein was assayed with 0.2 µCi of [14C]-phosphoethanolamine (P-Etn) (American Radiolabeled Chemical) in 50µl of reaction mixture of 50 mM MgCl2 ...
-
No products found
because this supplier's products are not listed.
Chiara E. Geyer, et al.,
bioRxiv - Immunology 2022
Quote:
... IL-6 concentration was determined using antibody pairs from U-CyTech Biosciences (Human IL-6 ELISA ...
-
No products found
because this supplier's products are not listed.
Esther B. Florsheim, et al.,
bioRxiv - Immunology 2023
Quote:
... or rabbit polyclonal anti-Fluoro-Gold primary antibody (1:1000 Fluorochrome) in the same blocking solution overnight for 16 h and then with Alexa Fluor 594-conjugated donkey anti-rabbit IgG secondary fluorescent antibody (1:500 dilution ...
-
No products found
because this supplier's products are not listed.
Piotr Przanowski, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... and Anti-β-actin (AC-74) antibody (GenWay Biotech Inc. GWB-A0AC74). Densitometry was performed with Fiji(Schindelin et al ...
-
No products found
because this supplier's products are not listed.
Elisangela Bressan, et al.,
bioRxiv - Genomics 2023
Quote:
... Primary antibodies were applied overnight at 4°C and included TH (Pel-Freez Biologicals #P40101 and Merck Millipore #AB9702 ...