-
No products found
because this supplier's products are not listed.
Aleksei Kuznetsov, et al.,
bioRxiv - Biochemistry 2020
Quote:
Human recombinant ACE2-His protein (Icosagen OÜ, Estonia, cat# P-302-100) and SARS-CoV-2 Spike protein S1 (Icosagen OÜ ...
-
No products found
because this supplier's products are not listed.
Zannel Blanchard, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... ER-Y537S and ER-D538G cell lines were transduced with CMV-Luciferase (firefly)-2A-GFP (RFP-Puro) (GenTarget Inc) lentiviral particles ...
-
No products found
because this supplier's products are not listed.
Megan N. Thomas, et al.,
bioRxiv - Microbiology 2023
Quote:
Serum samples collected from the indirect contact pigs at 11 DPC were prepared for the hemagglutination inhibition (HI) assay by receptor-destroying enzyme (RDE II; Hardy Diagnostics, Santa Maria, CA) treatment ...
-
No products found
because this supplier's products are not listed.
Hoa Quynh Do, et al.,
bioRxiv - Biochemistry 2021
Quote:
... and lipid-protein nanodiscs (MSP1D1-His-POPC, MSP1D1-His-DMPG, MSP1D1-His-DMPC, Cube Biotech) were used to solubilize in-situ synthesized PCFT ...
-
No products found
because this supplier's products are not listed.
Nuria Ferrandiz, et al.,
bioRxiv - Cell Biology 2022
Quote:
ER clearance was induced through application of rapamycin (Alfa Aesar) to final concentration of 200 nM ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Joe Jones, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... supplemented with Euroscript Reverse Transcriptase/RNase inhibitor (Eurogentec, RT-0125-ER) for reverse transcription of RNA ...
-
No products found
because this supplier's products are not listed.
Vincent Soubannier, et al.,
bioRxiv - Neuroscience 2019
Quote:
... human iPSC-derived astrocytes were incubated with tumour necrosis factor alpha (TNFa) (30 ng/ml; Cell Sciences; Newburyport, MA; Cat. No. CRT100B), interleukin alpha (IL-1a ...
-
No products found
because this supplier's products are not listed.
Laurence Abrami, et al.,
bioRxiv - Cell Biology 2020
Quote:
... L-alpha-phosphatidylserine (Avanti polar lipids 840032C), and L-alpha-phosphatidylethanolamine (Avanti polar lipids 840026C ...
-
No products found
because this supplier's products are not listed.
Sophie L. Lewandowski, et al.,
bioRxiv - Cell Biology 2020
Quote:
... with an alpha plate reader (TECAN Spark). After the perifusion ...
-
Estrogen receptor modulator 1 (compound 18) is an orally active and selective estrogen receptor...
Cat# S0503, SKU# S0503-5mg,
5mg, $247.00
Ask
Richard Kanyo, et al.,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
... Receptor inhibitors AM251 (Selleck Chemicals, Houston, TX, USA) and AM630 (Adooq Bioscience ...
-
No products found
because this supplier's products are not listed.
Peter Hanna, et al.,
bioRxiv - Neuroscience 2020
Quote:
... A quadripolar His catheter (Abbott) was placed via the right external jugular vein and advanced until a His signal was visualized while a quadripolar catheter was inserted via the right femoral vein and advanced to the right atrium ...
-
No products found
because this supplier's products are not listed.
Jun Kunimatsu, Hidetoshi Amita, Okihide Hikosaka,
bioRxiv - Neuroscience 2023
Quote:
... a tungsten electrode (Alpha Omega Engineering or FHC) was lowered into the striatum through a guide tube using a micromanipulator (MO-97S ...
-
No products found
because this supplier's products are not listed.
Agustina Rimondi, et al.,
bioRxiv - Microbiology 2022
Quote:
... Sera were treated with receptor-destroying enzyme (Accurate Chemical and Scientific Corp. ...
-
No products found
because this supplier's products are not listed.
Jing Zhao, et al.,
bioRxiv - Plant Biology 2023
Quote:
... His-tag antibody (Tiangen, Beijing, China) and GST antibody (Tiangen).
-
No products found
because this supplier's products are not listed.
Lisa Koshko, et al.,
bioRxiv - Neuroscience 2023
Quote:
... or alpha MSH (rabbit, Phoenix Pharmaceuticals INC, 1:1000) primary antibody ...
-
No products found
because this supplier's products are not listed.
Carlo Dal Lin, et al.,
bioRxiv - Cell Biology 2020
Quote:
... mouse anti-alpha-tubulin (α-tubulin) (EXBIO Praha, Czech Republic) diluted 1:500 ...
-
No products found
because this supplier's products are not listed.
Siran Zhu, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... 150 pmol of 6×His-streptavidin (ProteoGenix) was mixed with 5 μl of sieved beads (10% ...
-
No products found
because this supplier's products are not listed.
Johannes Zehnder, et al.,
bioRxiv - Biophysics 2021
Quote:
... Temperature stabilisation during all measurements was performed with a He-flow cryostat (ER 4118CF, Oxford Instruments) and a temperature control system (ITC 503 ...
-
No products found
because this supplier's products are not listed.
Gadisti Aisha Mohamed, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... anti-ER (Cell Marque, 249-R-15-ASR, clone: SP1, 1:70 dilution) with Opal 650 (Akoya Biosciences ...
-
No products found
because this supplier's products are not listed.
Lucia Gonzalo, et al.,
bioRxiv - Plant Biology 2021
Quote:
... 4°C and the supernatants were incubated overnight with 1/100 RNAPII or HIS antibodies (RNAP II AS11 1804, HIS AS20 4441, Agrisera) and 30 μl SureBeads (BioRad) ...
-
No products found
because this supplier's products are not listed.
Sadia Sultana, et al.,
bioRxiv - Microbiology 2021
Quote:
... incubated overnight with anti-His antibody (Cell Biolabs) and finally with horseradish peroxidase-conjugated goat anti-mouse IgG (Jackson Immuno-research Laboratory ...
-
No products found
because this supplier's products are not listed.
Michael P. Doyle, et al.,
bioRxiv - Immunology 2022
Quote:
... his-tagged YFV E protein (Meridian Life Science) was associated to the tips at 5 μg/mL for 60 sec ...
-
No products found
because this supplier's products are not listed.
Mayis Kaba, et al.,
bioRxiv - Cell Biology 2022
Quote:
... Alpha Fluor 488 amine (20 μg/mL, AAT Bioquest/Cat No. 1705) was added at room temperature for 30 min with agitation before overnight incubation with hIgG ...
-
No products found
because this supplier's products are not listed.
Ana Zúñiga, et al.,
bioRxiv - Synthetic Biology 2019
Quote:
... into 500μL of Azure Hi-Def medium (Teknova, 3H5000) supplemented with 0.4% of glycerol ...
-
No products found
because this supplier's products are not listed.
Arun Prasath Damodaran, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... mouse anti-His tag (HIS.H8 / EH158, Covalab, 1:2500), mouse anti-FLAG tag (clone M2-F1804 ...
-
No products found
because this supplier's products are not listed.
Krishnapriya Hari, et al.,
bioRxiv - Neuroscience 2021
Quote:
... including anti-α5 GABAA receptor subunit (AAP34984, Aviva Systems Biology, San Diego, USA), anti-α1 GABAA receptor subunit (224-2P ...
-
No products found
because this supplier's products are not listed.
Nathalie Bastié, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... Cells were synchronized in G1 by adding alpha-factor (Ref, Antibodies-online, ABIN399114) in the media every 30 minutes (1µg/mL final ...
-
No products found
because this supplier's products are not listed.
Julia A Alvarez, et al.,
bioRxiv - Microbiology 2024
Quote:
... 20% heat inactivated (HI) fetal bovine serum (FBS) (Omega Scientific), 1% penicillin-streptomycin (Life Technologies ...
-
No products found
because this supplier's products are not listed.
Sohail Jahid, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... His-Cdc42 was instead dialyzed with 20 µM GppNHp (Jena Bioscience) in the presence of 5 U of Quick-CIP alkaline phosphatase (New England Biolabs) ...
-
No products found
because this supplier's products are not listed.
Amanda Lillywhite, et al.,
bioRxiv - Neuroscience 2020
Quote:
... P-ser375 MOR (rabbit anti-mu opioid receptor Ser375, BIOSS-Stratech, bs-3724R, 1:500), and β-actin (mouse anti-β-actin ...
-
No products found
because this supplier's products are not listed.
Tony Ngo, et al.,
bioRxiv - Pharmacology and Toxicology 2020
Quote:
... and 1.0 μg/well of the indicated receptors using TransIT-X2 transfection reagent (Mirus Bio); the total transfected DNA was normalized to 3.0 μg/well for all wells using empty pcDNA3.1 ...
-
No products found
because this supplier's products are not listed.
Einat Bigelman, et al.,
bioRxiv - Cell Biology 2022
Quote:
... which recognizes the native form of the extracellular portion of the receptor (Biorbyt, England, clone orb399781) followed by flow cytometry analysis.
-
No products found
because this supplier's products are not listed.
Rory Henderson, et al.,
bioRxiv - Immunology 2023
Quote:
... The synthetic Toll-like receptor 7/8 agonist 3M-052 absorbed to ALUM (3M-052-ALUM) was used as the adjuvant for the vaccine immunogens ...
-
No products found
because this supplier's products are not listed.
Kui K. Chan, et al.,
bioRxiv - Biochemistry 2020
Quote:
... and anti-HIS-FITC (chicken polyclonal, 1/100 dilution; Immunology Consultants Laboratory) secondary antibodies for 20 minutes at 4°C ...
-
No products found
because this supplier's products are not listed.
Jan Steinkühler, et al.,
bioRxiv - Biophysics 2020
Quote:
... Human Transferrin – CF488A (Biotium) at 130 nM ...
-
No products found
because this supplier's products are not listed.
Vicente José Planelles-Herrero, et al.,
bioRxiv - Biochemistry 2023
Quote:
... a mix containing 50 μM taxol and 30 nM anti poly glutamylated alpha tubulin (GT335, AdipoGen Life Sciences) labelled with ATTO565 in imaging buffer was injected ...
-
No products found
because this supplier's products are not listed.
Saurabh Srivastava, et al.,
bioRxiv - Molecular Biology 2021
Quote:
The optimal receptor-binding domain (OBD) (100, 100) of Tetanus Toxin (Heavy Chain/B Subunit) was synthesized by GENEWIZ (incorporating flanking 5’ Hindlll and 3’ Nco1 restriction sites ...
-
Human Estrogen Receptor Alpha Protein is a recombinant Human protein expressed in E. coli.
Cat# abx167107-200UG,
200 µg USD $812.0
Ask
Michaela Frolikova, et al.,
bioRxiv - Cell Biology 2023
Quote:
... diluted 1:50 in 1% BSA in PBS and rabbit polyclonal anti-Folate receptor 4 (Juno) (abx102438, Abbexa, UK) diluted 1:50 in 1% BSA in PBS followed by 1 hr ...
-
No products found
because this supplier's products are not listed.
Huilei Wang, et al.,
bioRxiv - Biochemistry 2021
Quote:
... An adenovirus used to overexpress C-terminal His-tagged LOXL2 was purchased from Vector Biolabs. Vitamin E (α-Tocopherol ...
-
No products found
because this supplier's products are not listed.
Balaji Karthick Subramanian, et al.,
bioRxiv - Pathology 2019
Quote:
... Human primary podocytes from Celprogen Inc ...
-
No products found
because this supplier's products are not listed.
Manuel Göpferich, et al.,
bioRxiv - Neuroscience 2020
Quote:
... human FGF (20 ng/μl, ReliaTech) and human EGF (Promokine) ...
-
No products found
because this supplier's products are not listed.
Thomas Keating, et al.,
bioRxiv - Immunology 2021
Quote:
... 1:500 mouse anti-human C1q (Quidel) or 1:100 mouse anti-human Ficolin-3 (Hycult ...
-
No products found
because this supplier's products are not listed.
Meriem Belabed, et al.,
bioRxiv - Immunology 2023
Quote:
... anti-human CADM1 (clone 30, MBL International), anti-human CD206 (clone 15-2 ...
-
No products found
because this supplier's products are not listed.
V. Praveen Chakravarthi, et al.,
bioRxiv - Developmental Biology 2020
Quote:
... 30 IU of human chorionic gonadotropin (hCG; BioVendor) was injected intraperitoneally ...
-
No products found
because this supplier's products are not listed.
Michael M. Lutz, et al.,
bioRxiv - Microbiology 2019
Quote:
... Human Pancreatic Ductal Epithelial (HPDE) cells (Kerafast H6c7) were maintained in keratinocyte SFM (serum-free medium ...
-
Crystallized as zymogen and activated. Dialyzed against 1 mM HCl and lyophilized.
Cat# LS001334,
10 gm, $225.00
Ask
Alex M. Jaeger, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... 100-200 mg of tumor bearing lung tissue was then thoroughly minced with Noyes scissors, prior to incubation with digestion buffer (HBSS supplemented with 5% HI FBS, 125 U/mL collagenase IV (Worthington) and DNase (Roche ...
-
No products found
because this supplier's products are not listed.
Timothy S. Strutzenberg, et al.,
bioRxiv - Biophysics 2019
Quote:
... The His-SUMO solubility tag was cleaved using His-tagged SUMO protease (from RGO) by incubating at 4°C overnight while gently rocking in protein lobind tubes (Eppendorf). The flow through of the second affinity step was collected and concentrated prior to loading onto a Superdex S200 (26/60 ...
-
No products found
because this supplier's products are not listed.
Huu Tuan Nguyen, et al.,
bioRxiv - Bioengineering 2023
Quote:
Human umbilical vein endothelial cells (ECs, Angio-Proteomie, MA, USA) were cultured in Vasculife (LifeLine Cell Technology ...
-
No products found
because this supplier's products are not listed.
Qinghui Wang, et al.,
bioRxiv - Immunology 2022
Quote:
... Naïve CD3 human T cells were purchased from HemaCare (Lot #21068415). N/TERT-1 cells were a gift from the Rheinwald Lab (Dickson et al. ...