-
No products found
because this supplier's products are not listed.
Lanpeng Chen, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... anti-human Nanog and anti-human Oct-4 were obtained from Cell Science Signaling ...
-
No products found
because this supplier's products are not listed.
Hoa Quynh Do, et al.,
bioRxiv - Biochemistry 2021
Quote:
... and lipid-protein nanodiscs (MSP1D1-His-POPC, MSP1D1-His-DMPG, MSP1D1-His-DMPC, Cube Biotech) were used to solubilize in-situ synthesized PCFT ...
-
This product is currently in development. The lead time for this product may be several months....
Cat# abx172269-1ML,
1 ml USD $913.5
Ask
Michaela Frolikova, et al.,
bioRxiv - Cell Biology 2023
Quote:
... diluted 1:50 in 1% BSA in PBS and rabbit polyclonal anti-Folate receptor 4 (Juno) (abx102438, Abbexa, UK) diluted 1:50 in 1% BSA in PBS followed by 1 hr ...
-
No products found
because this supplier's products are not listed.
Bjoern Traenkle, et al.,
bioRxiv - Immunology 2021
Quote:
... an alpaca (Vicugna pacos) was immunized with the purified extracellular domains of human CD4 (aa26-390) recombinantly produced in HEK293 cells (antibodies-online GmbH, Germany). After initial priming with 1 mg ...
-
No products found
because this supplier's products are not listed.
Dustin M. McCraw, et al.,
bioRxiv - Microbiology 2019
Quote:
The sera and plasma were diluted 1:4 in RDE (RDE II, “Seiken”, receptor-destroying enzyme, cat. no. UCC-340-122, Accurate Chemical) and placed in a 37°C water bath overnight (18-20 hr) ...
-
No products found
because this supplier's products are not listed.
Luis Alfonso Yañez Guerra, Meet Zandawala,
bioRxiv - Evolutionary Biology 2023
Quote:
... HEK293-G5a (Angio-proteomie CAT no. cAP0200GFP-AEQ-Cyto) cells were cultured in 96 well-plates containing 100μl of DMEM (Thermo ...
-
No products found
because this supplier's products are not listed.
Michael G. Spelios, et al.,
bioRxiv - Immunology 2021
Quote:
... purified His-tagged ACE2 (EpiGentek) was added at a concentration of 100 ng/well (prepared with PBS ...
-
No products found
because this supplier's products are not listed.
Jing Zhao, et al.,
bioRxiv - Plant Biology 2023
Quote:
... His-tag antibody (Tiangen, Beijing, China) and GST antibody (Tiangen).
-
No products found
because this supplier's products are not listed.
Bryan J. González, et al.,
bioRxiv - Cell Biology 2021
Quote:
... and 2 µM R428 (Tyrosine kinase receptor AXL inhibitor) (ApexBio, A8329). From d1 to d11 media was changed every day and from d12 to d27 media was changed every other day ...
-
No products found
because this supplier's products are not listed.
Lucia Gonzalo, et al.,
bioRxiv - Plant Biology 2021
Quote:
... 4°C and the supernatants were incubated overnight with 1/100 RNAPII or HIS antibodies (RNAP II AS11 1804, HIS AS20 4441, Agrisera) and 30 μl SureBeads (BioRad) ...
-
No products found
because this supplier's products are not listed.
Matthew J. Lollar, et al.,
bioRxiv - Evolutionary Biology 2022
Quote:
... 54 g agar (Genesee Drosophila type II), 20 mL propionic acid ...
-
No products found
because this supplier's products are not listed.
Logan T. Blancett, et al.,
bioRxiv - Microbiology 2023
Quote:
... Fc receptors were blocked for 10 minutes with CD32/CD16 mAb (Leinco Technologies, Inc.). Cells were incubated with Zombie UV™ Fixable Viability Dye (BioLegend ...
-
No products found
because this supplier's products are not listed.
Hajera Amatullah, et al.,
bioRxiv - Immunology 2021
Quote:
Ten million naïve or LPS-stimulated (0.1mg/mL for 4 hours) human peripheral blood-derived macrophages were cross-linked and processed using truChIP kit (Covaris Inc), as described in detail before(Mehta et al. ...
-
No products found
because this supplier's products are not listed.
Ole A.W. Haabeth, et al.,
bioRxiv - Immunology 2021
Quote:
... 2 μg of the RBD-his mRNA or GFP mRNA (Trilink) was formulated in 6.6 μl of PBS pH 5.5 with 1.37 μl of 5mM CART and added to the cells ...
-
Recombinant Antigen
Cat# REC31685-100,
100µg USD $395.0
Ask
Maya Imbrechts, et al.,
bioRxiv - Immunology 2021
Quote:
... Spike Glycoprotein (Full-Length)-His (REC31868-500, The Native Antigen Company). Briefly ...
-
No products found
because this supplier's products are not listed.
Andrew J. Stout, et al.,
bioRxiv - Bioengineering 2022
Quote:
... or Beefy-R (Hi-Def B8 supplemented with 0.4 mg/mL RPI). Beefy-9 and Beefy-R were prepared immediately before use ...
-
No products found
because this supplier's products are not listed.
Matthew G. Marzo, et al.,
bioRxiv - Cell Biology 2019
Quote:
... Cells were lysed in a dounce-type tissue grinder (Wheaton) using ≥ 150 strokes (lysis was monitored by microscopy) ...
-
No products found
because this supplier's products are not listed.
N.D. Maxwell, et al.,
bioRxiv - Neuroscience 2023
Quote:
... CA) using probes against the leptin receptor mRNA (Cat# 415951) and Opal 650 dye kit (Akoya Biosciences, Marlborough, MA) to label LepR mRNA ...
-
No products found
because this supplier's products are not listed.
Francesca Curreli, et al.,
bioRxiv - Pharmacology and Toxicology 2020
Quote:
... The proteins were resolved on a NuPAGE Novex 4–12 % Bis-Tris Gel and immuno-detected with a human anti-ACE2 mAb (AC384) (Adipogen Life Sciences, San Diego, CA). The ECL Mouse IgG ...
-
No products found
because this supplier's products are not listed.
Jothi K. Yuvaraj, et al.,
bioRxiv - Neuroscience 2020
Quote:
... after which cells were investigated for ligand-induced receptor activation using a FLUOstar Omega plate reader (BMG Labtech, Ortenberg, Germany). Cells were tested in triplicates (technical replicates ...
-
No products found
because this supplier's products are not listed.
Yan Tang, et al.,
bioRxiv - Cancer Biology 2022
Quote:
Human and mouse MDK ELISA assays were performed using Human Midkine ELISA Kit PicoKine™ (EK1235, BOSTER) and Mouse MDK / Midkine (Sandwich ELISA ...
-
No products found
because this supplier's products are not listed.
Paulami Dey, et al.,
bioRxiv - Biochemistry 2023
Quote:
... the samples were analysed in a triple-quadrupole type mass spectrometer (Sciex QTRAP 5500) with Schmadzu HPLC unit ...
-
No products found
because this supplier's products are not listed.
Anna Schroeder, et al.,
bioRxiv - Neuroscience 2022
Quote:
... or 4% FluoroGold (Fluorochrome) were injected in ACx (same coordinates as for AAV) ...
-
No products found
because this supplier's products are not listed.
Sandra M. Holmberg, et al.,
bioRxiv - Microbiology 2023
Quote:
... a fluorogenic assay using the 4-methylumbelliferyl (4-MU)-linked substrate 4-MU-N-acetyl-α-D-neuraminic acid (sialic acid) (Carbosynth, UK) was performed ...
-
No products found
because this supplier's products are not listed.
Nicholas B. Karabin, et al.,
bioRxiv - Bioengineering 2020
Quote:
... Pooled human plasma was acquired from Zen-Bio Inc ...
-
No products found
because this supplier's products are not listed.
Nisha Dhanushkodi, et al.,
bioRxiv - Immunology 2022
Quote:
Vaginal swabs were collected daily using a Dacron swab (type 1; Spectrum Laboratories, Los Angeles, CA) starting from day 35 until day 42 post-challenge ...
-
No products found
because this supplier's products are not listed.
Myung Chung, et al.,
bioRxiv - Neuroscience 2024
Quote:
... HEK293-EGFP (GenTarget, Cat. No. #SC001), and NIH-3T3 (originally obtained from Riken Bioresource Research Center and gifted from Dr ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Kerrie L. Marie, et al.,
bioRxiv - Cancer Biology 2019
Quote:
... Lot# CA36131)/ 1:400 KDEL Receptor 3 (L95) polyclonal (Bioworld Technology Cat# BS3124 ...
-
No products found
because this supplier's products are not listed.
Madeleine F. Jennewein, et al.,
bioRxiv - Immunology 2021
Quote:
To investigate Fc receptor binding recombinant Fc receptors with an AviTag were biotinylated using a Bir500 kit (Avidity, Aurora, CO, USA) according to manufacturer’s instructions and purified using a Zeba Spin Desalting Column ...
-
No products found
because this supplier's products are not listed.
Siran Zhu, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... 150 pmol of 6×His-streptavidin (ProteoGenix) was mixed with 5 μl of sieved beads (10% ...
-
No products found
because this supplier's products are not listed.
Yunliang Zang, Eve Marder,
bioRxiv - Neuroscience 2021
Quote:
... A-type K current (IKA) and leak current (Ileak) ...
-
No products found
because this supplier's products are not listed.
Doris Krauter, et al.,
bioRxiv - Neuroscience 2021
Quote:
... using a diamond knife (Histo HI 4317, Diatome). Afterwards sections were stained according to Gallyas52 and with Methylene blue/ Azur II for 1 min ...
-
No products found
because this supplier's products are not listed.
Julian Schöllkopf, et al.,
bioRxiv - Pharmacology and Toxicology 2022
Quote:
N-terminally His-tagged Pasteurella multocida toxin (PMT) was coated at 10 µg/mL (500 ng/well ...
-
No products found
because this supplier's products are not listed.
Krishnapriya Hari, et al.,
bioRxiv - Neuroscience 2021
Quote:
... including anti-α5 GABAA receptor subunit (AAP34984, Aviva Systems Biology, San Diego, USA), anti-α1 GABAA receptor subunit (224-2P ...
-
No products found
because this supplier's products are not listed.
Grace Y. Liu, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Micropropagation Agar-Type II from Caisson Laboratories; rapamycin from LC Laboratories ...
-
No products found
because this supplier's products are not listed.
Elissa Tjahjono, et al.,
bioRxiv - Cell Biology 2021
Quote:
... and a Clark-type oxygen electrode (YSI 5301) (Yellow Springs Instrument ...
-
No products found
because this supplier's products are not listed.
Einat Bigelman, et al.,
bioRxiv - Cell Biology 2022
Quote:
... which recognizes the native form of the extracellular portion of the receptor (Biorbyt, England, clone orb399781) followed by flow cytometry analysis.
-
No products found
because this supplier's products are not listed.
Troy T. Rohn, et al.,
bioRxiv - Neuroscience 2023
Quote:
... or anti-5HT-2A receptor antibody (rabbit polyclonal, #24288) at 1:500 dilution (Immunostar, Hudson, WI). Secondary antibodies were conjugated to FITC or Cy3 ...
-
No products found
because this supplier's products are not listed.
Kari H. Ecklund, et al.,
bioRxiv - Cell Biology 2021
Quote:
Anti-His-coated 0.44 μm microbeads (PSS4; Spherotech; prepared as described previously72) were incubated with purified 6His-GFP-3HA-GST-dynein331-HALO in dynein trapping buffer (30 mM HEPES pH 7.2 ...
-
No products found
because this supplier's products are not listed.
Cathal Meehan, et al.,
bioRxiv - Biochemistry 2023
Quote:
... Recombinant IL-6 with an N-terminal his tag (Fitzgerald, Biosynth Ltd.) was immobilized on His-Pur™ Ni-NTA Resin (ThermoScientific ...
-
No products found
because this supplier's products are not listed.
Michael D. Schaid, et al.,
bioRxiv - Pharmacology and Toxicology 2020
Quote:
... Excitation (x) or emission (m) filters (ET type; Chroma Technology) were used in combination with an FF444/521/608-Di01 dichroic beamsplitter (Semrock ...
-
No products found
because this supplier's products are not listed.
Seong-Beom Park, et al.,
bioRxiv - Neuroscience 2021
Quote:
... dehydrated using an ethanol series (50%, 4 min; 75%, 4 min; 95%, 4 min; 100%, 4 × 4 min) and cleared with Histoclear II (National Diagnostics, Atlanta, GA, USA) (3 × 4 min) ...
-
No products found
because this supplier's products are not listed.
Amanda G. Gibson, et al.,
bioRxiv - Neuroscience 2021
Quote:
... either high-potassium ACSF (20 mM K+) or the neurokinin 3 receptor agonist senktide (100nM; Phoenix Pharmaceuticals, Burlingame, CA) was bath-applied ...
-
No products found
because this supplier's products are not listed.
Liam Hudson, et al.,
bioRxiv - Biochemistry 2023
Quote:
... C-His tagged IDH1 R132H (Met1-Leu414) was purchased from G-Biosciences (BAN1708, 50 µg). N-His and GST tagged USP7 (Lys208-Glu560 ...
-
No products found
because this supplier's products are not listed.
Balaji Karthick Subramanian, et al.,
bioRxiv - Pathology 2019
Quote:
... Human primary podocytes from Celprogen Inc ...
-
No products found
because this supplier's products are not listed.
Veronika Miskolci, et al.,
bioRxiv - Immunology 2020
Quote:
... fine tip (type E) of a line-powered thermal cautery instrument (Stoelting, Wood Dale, IL) was placed into the E3 medium ...
-
No products found
because this supplier's products are not listed.
Mutsumi Kobayashi, et al.,
bioRxiv - Developmental Biology 2022
Quote:
... Human iPSCs were dissociated using Accutase (Innovative Cell Technologies, AT104) and suspended in mTeSR plus (Stemcell Technologies ...
-
No products found
because this supplier's products are not listed.
Qinghui Wang, et al.,
bioRxiv - Immunology 2022
Quote:
... Naïve CD3 human T cells were purchased from HemaCare (Lot #21068415). N/TERT-1 cells were a gift from the Rheinwald Lab (Dickson et al. ...
-
No products found
because this supplier's products are not listed.
Nicole Stantial, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... Cells were lysed at 4° using a Bead Beater (Biospec) for two 50-sec rounds ...