-
Recombinant Antigen
Cat# REC31685-100,
100µg USD $395.0
Ask
Maya Imbrechts, et al.,
bioRxiv - Immunology 2021
Quote:
... His-tag labeled SARS-CoV-2 RBD (The Native Antigen Company) was biotinylated with the EZ-Link Sulfo-NHS-LC-Biotin kit (Thermofisher Scientific ...
-
No products found
because this supplier's products are not listed.
Michael G. Spelios, et al.,
bioRxiv - Immunology 2021
Quote:
... His-tagged peptide containing the SARS-CoV-2-specific furin motif (EpiGentek), and His-tagged SARS-CoV-2 S1 RBD protein lacking the S1/S2 boundary furin site (EpiGentek ...
-
No products found
because this supplier's products are not listed.
Megan N. Thomas, et al.,
bioRxiv - Microbiology 2023
Quote:
Serum samples collected from the indirect contact pigs at 11 DPC were prepared for the hemagglutination inhibition (HI) assay by receptor-destroying enzyme (RDE II; Hardy Diagnostics, Santa Maria, CA) treatment ...
-
No products found
because this supplier's products are not listed.
William Lee, et al.,
bioRxiv - Molecular Biology 2023
Quote:
TOM20 and H2B Type 1A ORFs were amplified by PCR from human heart cDNA (Zyagen). The amplicons were cloned into the pT7Blue cloning vector (Novagen ...
-
No products found
because this supplier's products are not listed.
Frederik Fleissner, et al.,
bioRxiv - Biophysics 2020
Quote:
A plasmid coding for human vimentin containing a C-terminal His-tag (EX-D0114-B31, Tebu-bio, Germany) was transformed into E ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Nadine R King, et al.,
bioRxiv - Cell Biology 2023
Quote:
... 2 mg/ml Human Serum Albumin (HSA; Irvine Scientific), 10 μg/ml insulin (Sigma) ...
-
No products found
because this supplier's products are not listed.
Joanna Kim, John A. Cooper,
bioRxiv - Cell Biology 2020
Quote:
... polyclonal rabbit anti-human septin 2 (Atlas Antibodies, Cat. # HPA018481), mouse monoclonal anti-human GAPDH (clone 6C5) ...
-
No products found
because this supplier's products are not listed.
Nanami Sakata, et al.,
bioRxiv - Plant Biology 2022
Quote:
... L-His (Tokyo Chemical Industry), and L-Lys (Nacalai tesque ...
-
No products found
because this supplier's products are not listed.
Yunye Zhu, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... Transformants scraped from densely plated transformation plates were inoculated into fresh SC-His medium with 2% raffinose (Amresco, J392) at 0.25 x 107 cells/ml and grown until 0.5-0.8 x 107 cells/ml ...
-
No products found
because this supplier's products are not listed.
Ethan Chervonski, et al.,
bioRxiv - Neuroscience 2020
Quote:
... CD-1 mice were injected with human adenovirus type 5 (dE1/E3) expressing mCherry protein under the control of a CMV promoter (Vector Biolabs) using either the 3D-printed or clay head mold ...
-
No products found
because this supplier's products are not listed.
Shutang Tan, et al.,
bioRxiv - Plant Biology 2019
Quote:
... membranes were incubated for 2 h at room temperature with an anti-His HRP-(horseradish peroxidase) conjugated antibody (1:4000; Agrisera) or an anti-GST HRP-conjugated antibody (1:4000 ...
-
No products found
because this supplier's products are not listed.
Shih-Heng Chen, et al.,
bioRxiv - Neuroscience 2019
Quote:
Mycoplasma-free HEK293-AAV cells (Cell Biolabs Inc., Cat. # AAV-100) were maintained in Dulbecco’s modified Eagle’s medium (DMEM ...
-
No products found
because this supplier's products are not listed.
Thomas S. Lisse,
bioRxiv - Cancer Biology 2020
Quote:
... The vitamin D receptor antagonist ZK159222 (VAZ, Toronto Research Chemicals) was reconstituted in ethanol and kept at −80°C (Ochiai E et al ...
-
No products found
because this supplier's products are not listed.
Yan Li, et al.,
bioRxiv - Neuroscience 2023
Quote:
... or anti-PAC1 receptor (1:50 dilution, LifeSpan BioSciences, Inc.) at 4°C overnight ...
-
No products found
because this supplier's products are not listed.
Erich D. Jarvis, et al.,
bioRxiv - Genomics 2022
Quote:
... All data types (Pacbio CLR ...
-
No products found
because this supplier's products are not listed.
Rachel Yamin, et al.,
bioRxiv - Immunology 2022
Quote:
... Afucosylated human IgG1 was generated in the presence of 0.2 mM 2-deoxy-2-fluoro-l-fucose (2FF) (Carbosynth, MD06089) during transfection of recombinant antibodies42 ...
-
No products found
because this supplier's products are not listed.
Peter Vandeberg, et al.,
bioRxiv - Immunology 2020
Quote:
Anti-SARS-CoV-2 IgG titers were determined using Human Anti-SARS-CoV-2 Virus Spike 1 (S1) IgG assay (Alpha Diagnostic). hIVIG batches were tested using multiple serial dilutions and a curve constructed by plotting the log of the optical density as a function of the log of the dilution ...
-
No products found
because this supplier's products are not listed.
Rocher Caroline, et al.,
bioRxiv - Zoology 2020
Quote:
... or type IV collagen (Eurogentec) (1:200) ...
-
No products found
because this supplier's products are not listed.
Chien-Wei Wang, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... Recombinant His-tagged streptavidin (Fitzgerald Industries, Acton, MA) at a concentration of 0.75 μM was used as a negative control molecule ...
-
No products found
because this supplier's products are not listed.
Alberto Domingo López-Muñoz, et al.,
bioRxiv - Microbiology 2021
Quote:
... and human anti-SARS-CoV-2 N mAb (N18) followed by IRDye® 680RD Goat anti-Human IgG Secondary Ab (LI-COR # 926-68078).
-
No products found
because this supplier's products are not listed.
Amrita Sule, et al.,
bioRxiv - Cancer Biology 2021
Quote:
YFP-ATM was immunoprecipitated from stably transfected HEK293 cells by GFP-TRAP (Chromotek). The immunoprecipitates were suspended in kinase assay buffer containing 2 μCi of [γ-32P] ATP ...
-
No products found
because this supplier's products are not listed.
Pooja Gangras, et al.,
bioRxiv - Molecular Biology 2019
Quote:
... PCR products were analyzed by separation of mutant and wild-type alleles on a 2% agarose gel stained with Gel Red (Biotium). Primer sequences are listed in Table S4.
-
No products found
because this supplier's products are not listed.
Kerstin Voelkl, et al.,
bioRxiv - Neuroscience 2023
Quote:
... mouse anti-His (Dianova, DIA-900-100, 1:1,000), chicken anti-EGFP (Invitrogen ...
-
No products found
because this supplier's products are not listed.
Satoshi Imanishi, et al.,
bioRxiv - Pharmacology and Toxicology 2022
Quote:
... and the corresponding His tag (R06-32BH) were obtained from SignalChem Lifesciences (Richmond ...
-
No products found
because this supplier's products are not listed.
Meng Zhang, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... Fluorescence intensity of Tb3+-labelled receptors was measured on an Infinite M1000 fluorescence plate reader (Tecan) with an excitation wavelength of 340 nm and emission wavelength of 620 nm ...
-
No products found
because this supplier's products are not listed.
Andrew J. Stout, et al.,
bioRxiv - Bioengineering 2022
Quote:
... or Beefy-R (Hi-Def B8 supplemented with 0.4 mg/mL RPI). Beefy-9 and Beefy-R were prepared immediately before use ...
-
No products found
because this supplier's products are not listed.
Ben S. Ou, et al.,
bioRxiv - Bioengineering 2023
Quote:
... HIS Lite Cy3 Bis NTA-Ni Complex was purchased from AAT Bioquest. Unless otherwise stated ...
-
No products found
because this supplier's products are not listed.
Yash Agarwal, et al.,
bioRxiv - Immunology 2020
Quote:
... Paraffin embedded fixed sections were stained via hematoxylin and eosin or with indicated human antibodies 24 (anti-human CD45-Biocare Medical Cat. No. CME PM016AA; anti-human CD3-Biocare Medical Cat ...
-
No products found
because this supplier's products are not listed.
Matthew G. Marzo, et al.,
bioRxiv - Cell Biology 2019
Quote:
... Cells were lysed in a dounce-type tissue grinder (Wheaton) using ≥ 150 strokes (lysis was monitored by microscopy) ...
-
No products found
because this supplier's products are not listed.
Sumona P. Dhara, et al.,
bioRxiv - Neuroscience 2019
Quote:
... Reactions were quenched in heat inactivated fetal calf serum (HI-FCS; Gemini Bio-Products) in DMEM/F12 (Gibco ...
-
No products found
because this supplier's products are not listed.
Sean Li, et al.,
bioRxiv - Biochemistry 2022
Quote:
Two types of syringe filters were purchased from Phenomenex (Torrance, CA) and used for the solubility sample treatment prior to HPLC analysis ...
-
No products found
because this supplier's products are not listed.
Assaf Alon, et al.,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
Purified σ2 receptor was reconstituted into lipidic cubic phase (LCP) by mixing with a 10:1 (w:w) mix of monoolein (Hampton Research) with cholesterol (Sigma Aldrich ...
-
No products found
because this supplier's products are not listed.
HR Holmes, et al.,
bioRxiv - Bioengineering 2024
Quote:
... we diluted samples of gamma-irradiated SARS-CoV-2 virus isolate USA-WA1/2020 (BEI #NR-52287) in human nasal wash (Lee Biosolutions #991-26-P) which were used as reference samples ...
-
No products found
because this supplier's products are not listed.
Chutima Rattanasopa, et al.,
bioRxiv - Physiology 2022
Quote:
... followed by 10 week western-type diet feeding (WTD; D12079B, Research Diets). Half the mice (assigned randomly ...
-
No products found
because this supplier's products are not listed.
Aum R. Patel, et al.,
bioRxiv - Microbiology 2021
Quote:
Normal Adult Human Dermal Fibroblasts and Normal Human Skeletal Muscle Satellite Cells (SkMc) (Lifeline Cell Technologies, USA) were cultured using FibroLife S2 Medium and StemLife SK Medium ...
-
No products found
because this supplier's products are not listed.
Juliano V Alves, et al.,
bioRxiv - Pharmacology and Toxicology 2023
Quote:
... L-type calcium channel blocker (Nifedipine, Alfa Aesar, catalog number: J62811, 10−8 M); Bradykinin (MedChemExpress ...
-
No products found
because this supplier's products are not listed.
S. Jordan Kerns, et al.,
bioRxiv - Cancer Biology 2021
Quote:
Human alveolar epithelial cells (Cell Biologics, Accegen) were cultured using SABM medium (Lonza ...
-
No products found
because this supplier's products are not listed.
Katerina Jerabkova, et al.,
bioRxiv - Cell Biology 2020
Quote:
... human polyclonal CREST (Antibodies Incorporated, 15 234), rabbit polyclonal Aurora B (Abcam ab2254) ...
-
The PRG-2 formulation allows a very substantial reduction (<40%) in the amount of Trypsin (BAEE...
Cat# 4Z0-310,
100.0 mL, $68.0
Ask
Changsheng Chen, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Human umbilical vein endothelial cells (HUVECs, Cell System) were cultured in endothelial cell growth medium according to the protocol provided by the manufacturer (VascuLife ...
-
No products found
because this supplier's products are not listed.
Adrià Sogues, et al.,
bioRxiv - Microbiology 2019
Quote:
... A 10 mM lipids chloroform solution made of an 8:2 mixture of 1-palmitoyl-2-oleoyl phosphatidylcholine (POPC) and 1-palmitoyl-2-oleoylglycero-3-phosphoglycerol (POPG) (Avanti Polar Lipids). Chloroform was removed by evaporation under vacuum conditions and the dried phospholipid film was resuspended in a mixture of diethyl ether and buffer (25 mM Hepes pH 7.4 ...
-
No products found
because this supplier's products are not listed.
Alexander B. Coley, et al.,
bioRxiv - Cancer Biology 2021
Quote:
Human embryonic kidney (HEK293) cell line was obtained from GenLantis (San Diego, CA) and cultured in MEM (Mediatech ...
-
No products found
because this supplier's products are not listed.
Kerrie L. Marie, et al.,
bioRxiv - Cancer Biology 2019
Quote:
... Lot# CA36131)/ 1:400 KDEL Receptor 3 (L95) polyclonal (Bioworld Technology Cat# BS3124 ...
-
No products found
because this supplier's products are not listed.
MEENAKSHI TETORYA, et al.,
bioRxiv - Plant Biology 2023
Quote:
His-tagged GMA4CG_WT and GMA4CG_V6 was obtained from Biomatik Inc ...
-
No products found
because this supplier's products are not listed.
Matthew J. Lollar, et al.,
bioRxiv - Evolutionary Biology 2022
Quote:
... 54 g agar (Genesee Drosophila type II), 20 mL propionic acid ...
-
No products found
because this supplier's products are not listed.
Kari H. Ecklund, et al.,
bioRxiv - Cell Biology 2021
Quote:
Anti-His-coated 0.44 μm microbeads (PSS4; Spherotech; prepared as described previously72) were incubated with purified 6His-GFP-3HA-GST-dynein331-HALO in dynein trapping buffer (30 mM HEPES pH 7.2 ...
-
No products found
because this supplier's products are not listed.
Shi-Xun Ma, et al.,
bioRxiv - Neuroscience 2020
Quote:
F2 SILAM wide type female mice were purchased from Cambridge Isotope Laboratories and then crossed with regular C57BL6 wild type males by fed with stable isotope labeling using amino acids in cell culture (SILAC ...
-
No products found
because this supplier's products are not listed.
Damian Dudka, R. Brian Akins, Michael A. Lampson,
bioRxiv - Cell Biology 2023
Quote:
... Centromeres were labeled with CREST (human anti-human Anti-Centromere Antibody, 1:200, Immunovision, HCT-0100) and an Alexa Fluor 594–conjugated goat anti-human secondary antibody (ThermoFisher ...
-
No products found
because this supplier's products are not listed.
Joelle P. Straehla, et al.,
bioRxiv - Bioengineering 2021
Quote:
Human iPS-ECs (Fujifilm Cellular Dynamics, 11713), human brain PCs and ACs (ScienCell) ...
-
No products found
because this supplier's products are not listed.
Jianfang Li, et al.,
bioRxiv - Developmental Biology 2021
Quote:
... Human C-peptide levels in isolated plasma were quantified using the STELLUX Chemi Human C-peptide ELISA kit (ALPCO Diagnostics) according to the manufacturer’s instructions.