-
No products found
because this supplier's products are not listed.
Ekaterina Buzun, et al.,
bioRxiv - Microbiology 2023
Quote:
... for 16 h at 37 °C under anaerobic conditions (10 % H2, 10 % CO2, 80 % N2; Coy Lab Products). For growths utilizing a sole carbon source ...
-
No products found
because this supplier's products are not listed.
Macarena S. Arrázola, et al.,
bioRxiv - Neuroscience 2022
Quote:
... the tissue was pre- treated for 10 min in potassium permanganate and then incubated for 10 min in the dark at 25 °C in Fluoro-Jade C and DAPI (Biosensis, TR-100-FJ). The tissue was then washed with water and let dry overnight ...
-
No products found
because this supplier's products are not listed.
Irina Sbornova, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Whole eye blots were probed overnight at 4 °C with 1 of two PDE11A antibodies: the pan-PDE11A antibody PD11-112 (1:1000, rabbit, Fabgennix) or the PDE11A4-specific antibody PDE11A#1-8113A (1:10,000 ...
-
No products found
because this supplier's products are not listed.
Hitika Gulabani, et al.,
bioRxiv - Plant Biology 2021
Quote:
... rinsed and incubated overnight at 4°C with indicated primary antibodies [anti-SNC1 (Abiocode; R3588-1), anti-PR1 ...
-
No products found
because this supplier's products are not listed.
Danielle L. Michell, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... and incubated overnight with rocking at 4°C with anti-human apoA-I primary antibody (mouse monoclonal, 1:8000, Meridian Life Sciences). Membranes were washed 3X for 10min with 1X TBS-T (0.1% Tween 20 ...
-
No products found
because this supplier's products are not listed.
Shuang Fu, et al.,
bioRxiv - Biophysics 2022
Quote:
... Ara-C (2 mM, TargetMol, T1272) was added to the medium to inhibit neural stem cell proliferation ...
-
No products found
because this supplier's products are not listed.
Xiaoqi Zhu, et al.,
bioRxiv - Neuroscience 2020
Quote:
... and then centrifuged at 1000 ×g/min for 10 min at 4°C to obtain plasma for measuring fructosamine with fructosamine reagents (IDEXX Catalyst™ Test; Westbrook, ME, USA) on IDEXX VetTest equipment ...
-
No products found
because this supplier's products are not listed.
Tate Tabtieng, et al.,
bioRxiv - Microbiology 2022
Quote:
iSLK.219 and iSLK.RTA cells were seeded onto T25 flasks at a density of 16,700 cells/cm2 and induced with doxycycline in the presence or absence of IDN-6556 (10 μM) and a mixture of neutralizing antibodies against type I IFNs at a 1:500 dilution (39000-1; PBL Assay Science). The media was replaced at day 2 post reactivation with fresh doxycycline ...
-
No products found
because this supplier's products are not listed.
Lisa-Marie Appel, et al.,
bioRxiv - Biochemistry 2022
Quote:
Crystalization was performed at at 22°C or 4°C using a sitting-drop vapour diffusion technique and micro-dispensing liquid handling robot Mosquito (TTP labtech). The best diffracting crystals of SHARP SPOC:1xS5P CTD were grown at 22°C in conditions E9 from ShotGun HT screen (SG1 HT96 Molecular Dimensions ...
-
No products found
because this supplier's products are not listed.
Saejeong Park, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... fixed in warm 4% paraformaldehyde (Thomas Scientific, 37 °C) for 5 min and washed with PBS 3 times ...
-
Cat# AG299,
USD $199.0/10.0ml
Ask
Fujun Hou, et al.,
bioRxiv - Microbiology 2021
Quote:
... ICP27 antibody (Virusys, 1113), 1:5000 ...
-
No products found
because this supplier's products are not listed.
Hannah A. Pizzato, et al.,
bioRxiv - Immunology 2023
Quote:
... or C5 antibody (Quidel) for 30min at 4°C ...
-
No products found
because this supplier's products are not listed.
Huiliang Zhang, et al.,
bioRxiv - Cell Biology 2020
Quote:
... 10 uM (-)-Blebbistatin (Toronto Research Chemicals) was included ...
-
No products found
because this supplier's products are not listed.
Oksana Y. Dudaryeva, et al.,
bioRxiv - Bioengineering 2021
Quote:
... by dialysis at 4 °C (1000 g mol-1 MWCO; Spectrum Laboratories), 4 times 6 h ...
-
WB, IHC,ELISA
Cat# A5266, SKU# A5266-20ul,
20ul, $47.00
Ask
Xuxiao He, et al.,
bioRxiv - Cancer Biology 2020
Quote:
... cell lysates were incubated with antibody-Flag or antibody-Myc affinity gel (Bimake) overnight at 4°C ...
-
No products found
because this supplier's products are not listed.
Katelyn A. Bustin, et al.,
bioRxiv - Neuroscience 2023
Quote:
... (Bullet Blender, BBY24M model, Next Advance, Inc., speed 8, 3 min, 4 °C), samples were diluted in PBS (500 μL ...
-
No products found
because this supplier's products are not listed.
Ryan Joseph Tan, Michael D. Rugg, Bradley C. Lega,
bioRxiv - Neuroscience 2020
Quote:
... with form 10 to 14 recording contacts arrayed at 4-5mm intervals along the shaft of the electrode (number of contacts is uniformly 10 with variable spacing for Ad-tech electrodes, but 10-14 with uniform spacing for PMT electrodes depending upon the overall depth of insertion).
-
No products found
because this supplier's products are not listed.
Monica L. Husby, et al.,
bioRxiv - Microbiology 2022
Quote:
... PB buffer was added to a 10-mm path-length Spectrosil Far UV Quartz cuvette (Starna Cells CatID: 21-Q-10) and a background spectra was collected and autosubtracted from VLP samples ...
-
No products found
because this supplier's products are not listed.
Sylvie Deborde, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... Experiments were performed at 37°C with a MFP-3D-BIO AFM microscope (Oxford Instruments). Fluorescent images of GFP-expressing HEI-286 SCs and RFP-expressing MiaPaCa-2 cancer cells were acquired together with the stiffness maps ...
-
No products found
because this supplier's products are not listed.
Marissa Lindman, et al.,
bioRxiv - Immunology 2023
Quote:
... IFNAR-1 monoclonal antibody (MAR1-5A3, Leinco Technologies) or isotype control (GIR-208 ...
-
No products found
because this supplier's products are not listed.
Cinzia Klemm, Gudjon Olafsson, Peter H Thorpe,
bioRxiv - Cell Biology 2023
Quote:
... These donor strains were then mated with members of the GFP collection on rectangular agar plates using a pinning robot (ROTOR robot, Singer Instruments, UK) in 4 replicates and 1536 colonies per plate ...
-
No products found
because this supplier's products are not listed.
Adam J. Rauckhorst, et al.,
bioRxiv - Biochemistry 2023
Quote:
... 10 minutes and incubated with primary antibodies diluted in Normal Antibody Diluent (ScyTek Laboratories, ABB125) at 4°C overnight ...
-
No products found
because this supplier's products are not listed.
Carl-Fredrik Bowin, et al.,
bioRxiv - Pharmacology and Toxicology 2022
Quote:
... Venus fluorescence was measured first and subsequently 10 µl of Coelenterazine h (Biosynth C-7004) (2.5 µM final concentration ...
-
No products found
because this supplier's products are not listed.
Elisangela Bressan, et al.,
bioRxiv - Genomics 2023
Quote:
... Primary antibodies were applied overnight at 4°C and included TH (Pel-Freez Biologicals #P40101 and Merck Millipore #AB9702 ...
-
No products found
because this supplier's products are not listed.
Alexis Vivoli, et al.,
bioRxiv - Cell Biology 2021
Quote:
... islets were washed once with D-PBS + 2 mM EDTA solution (339xg, 3 min, 4°C) and digested by enzymatic disaggregation for 10 min at 37°C using Accutase (Innovative Cell Technologies Inc., San Diego, CA, USA). The reaction was stopped using islet culture medium and the islet cell suspension was washed once with PBS and dead cells labeled using the LIVE/DEAD™ Fixable Aqua Dead Cell Stain Kit (405 nm ...
-
No products found
because this supplier's products are not listed.
Ute A. Hoffmann, et al.,
bioRxiv - Microbiology 2023
Quote:
... Cells were harvested by centrifugation (6,000 g, 10 min, 4°C) and lysed using a French-press (Constant Systems) at 36,000 ps ...
-
No products found
because this supplier's products are not listed.
Sacha Escamez, et al.,
bioRxiv - Plant Biology 2023
Quote:
... sulphuric acid (fraction of sulphuric acid based on the mass of the whole reaction mixture) during 10 min at 165°C in a single-mode microwave system (Initiator Exp, Biotage, Sweden), or remained untreated ...
-
No products found
because this supplier's products are not listed.
Yongsung Kim, et al.,
bioRxiv - Genomics 2024
Quote:
42 °C Incubator (Boekel Scientific™ model no ...
-
No products found
because this supplier's products are not listed.
E.E. Van Haaften, et al.,
bioRxiv - Bioengineering 2020
Quote:
... the supernatants were consecutively incubated with antibody-conjugated MagPlex microspheres (1 h), biotinylated antibodies (1 h), and streptavidin-phycoerythrin (10 min, diluted in high performance ELISA (HPE) buffer (Sanquin)) ...
-
No products found
because this supplier's products are not listed.
Natalia Gebara, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... and 2% Chang Medium C (Irvine Scientific), 20% Fetal Calf Serum (Invitrogen ...
-
No products found
because this supplier's products are not listed.
Emily K. Sims, et al.,
bioRxiv - Pathology 2019
Quote:
... Three of the donors with type 1 diabetes had detectable random serum C-peptide and 13 were classified by nPOD as C-peptide negative (random serum C-peptide <0.017nmol/L via TOSOH immunossay) (12) ...
-
No products found
because this supplier's products are not listed.
Thanh Ngoc Nguyen, et al.,
bioRxiv - Cell Biology 2023
Quote:
... equipped with a 45 °C diamond knife (Diatome) was used to section the resin embedded samples ...
-
No products found
because this supplier's products are not listed.
Poonam Thakur, Kelvin Luk, Jochen Roeper,
bioRxiv - Neuroscience 2019
Quote:
... D-AP5 (10 µM; Biotrend) and gabazine (SR95531 ...
-
No products found
because this supplier's products are not listed.
Sami T. Tuomivaara, et al.,
bioRxiv - Biochemistry 2023
Quote:
... supplemented with 10% FBS (Axenia BioLogix) on 3.5 cm (for optimizing conditions) ...
-
No products found
because this supplier's products are not listed.
Yanisa Anaya, et al.,
bioRxiv - Immunology 2024
Quote:
... secondary antibody (Goat-Anti-Rabbit Secondary Antibody, Protein Simple, Cat-No. 040-656), and performed the necessary washing steps between incubations ...
-
No products found
because this supplier's products are not listed.
Julia Fath, et al.,
bioRxiv - Cell Biology 2022
Quote:
... with 1 μM TAMRA-sheperdin-C-ter BDNF (TAMRA-KHSSGCAFLKKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France), or with TAMRA fluorophore alone for 20 minutes ...
-
No products found
because this supplier's products are not listed.
Joshua A. Beitchman, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Body temperature was maintained at 37 °C with isothermal heating pads (Braintree Scientific, MA). A midline incision was made in which the skin ...
-
No products found
because this supplier's products are not listed.
Mastura Akter, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Stainless steel guide cannulae (Double/O.D.0.41mm-27G/C, cat # 62069, RWD life science.com.ltd.) were bilaterally positioned into ACC region (2.4 mm anterior to bregma and 0.5 mm lateral from midline ...
-
No products found
because this supplier's products are not listed.
Chao Wang, et al.,
bioRxiv - Cell Biology 2019
Quote:
... anti-mouse-HRP antibody (ImmunoVision Technologies) was added and the cells were incubated with the secondary antibody for 2 hrs ...
-
No products found
because this supplier's products are not listed.
Amanda M. Travis, et al.,
bioRxiv - Cell Biology 2022
Quote:
... and C-terminal MYC tag was placed in front of human NPHP3 (GeneCopoeia GC-H2370). All mutations to replace the lipidated cysteine with alanine were made using PCR mutagenesis (Weiner et al. ...
-
No products found
because this supplier's products are not listed.
Tsuyoshi Hirashima, Michiyuki Matsuda,
bioRxiv - Developmental Biology 2022
Quote:
... or DAPI (Dojindo Molecular Technologies, #D523-10, 1:200). The samples were mounted with 10 µL of 1% agarose gel onto a glass-based dish (Greiner Bio-One ...
-
No products found
because this supplier's products are not listed.
Atsushi Taguchi, Suzanne Walker,
bioRxiv - Microbiology 2021
Quote:
... 10% glycerol) using a glass dounce tissue grinder (Wheaton). The resulting mixture was stirred for 1 h at 4°C before ultracentrifugation (100,000 x g ...
-
No products found
because this supplier's products are not listed.
Molly C. McCloskey, et al.,
bioRxiv - Bioengineering 2022
Quote:
... 20°C with equivalent volumes of 1-Step Polymorphs solution (Accurate Chemical & Scientific Co, Westbury, NY). Following centrifugation ...
-
No products found
because this supplier's products are not listed.
Anna Badner, et al.,
bioRxiv - Neuroscience 2020
Quote:
... A 10 μL Hamilton syringe (Cat#87930; Hamilton Company, Reno, NV) with a 1” 30g blunt needle was mounted into an UMP-3 (World Precision Instruments ...
-
No products found
because this supplier's products are not listed.
Amado Carreras-Sureda, et al.,
bioRxiv - Biochemistry 2021
Quote:
... ORAI1 was imaged using ZET488/10 excitation filter (Chroma Technology Corp.). STIM1 cherry (in HEK-293 cells ...
-
No products found
because this supplier's products are not listed.
Sing Teng Chua, et al.,
bioRxiv - Plant Biology 2023
Quote:
... sublimated at -90°C (2 minutes) and finally sputter coated with platinum (10 nm; Quorum Technologies Q150T ES).
-
No products found
because this supplier's products are not listed.
Priya Gambhir, et al.,
bioRxiv - Plant Biology 2022
Quote:
... Ten micrograms of total protein were separated on 10% SDS- PAGE gel and were followed by protein blot analysis using mouse anti- methylglyoxal monoclonal antibodies (Cell Biolabs, Catalog number- STA-011).
-
No products found
because this supplier's products are not listed.
Yuling Han, et al.,
bioRxiv - Microbiology 2020
Quote:
... in the presence of SFD containing either a combination of five factors (3 μM CHIR99021, 10 ng/ml human FGF10, 10 ng/ml human FGF7, 10 ng/ml human BMP-4, and 50 nM ATRA), or three factors (3 μM CHIR99021 ...
-
No products found
because this supplier's products are not listed.
Adrien Chauvier, et al.,
bioRxiv - Molecular Biology 2024
Quote:
... 10 µM ApU dinucleotide primer (Trilink), and 50 nM DNA template ...
-
No products found
because this supplier's products are not listed.
Jeremy A. Spool, et al.,
bioRxiv - Neuroscience 2020
Quote:
... vertical puller (PC-10; Narishige International USA). Positive pressure was applied to each pipette while moving through aCSF and tissue ...