-
No products found
because this supplier's products are not listed.
Anna Lipońska, et al.,
bioRxiv - Microbiology 2024
Quote:
... For proteins with his-tag we used anti-6xHis-tag primary antibody (Covalab, ref. HIS.HS/ EH158) in dilution 1:2 000 detected with anti-mouse IRdye 800CW (LI-COR ...
-
No products found
because this supplier's products are not listed.
Karen M. Dunkerley, et al.,
bioRxiv - Biochemistry 2021
Quote:
... Protein phosphorylation was monitored to completion using Phos-Tag AAL™ (NARD Institute Ltd) SDS–PAGE ...
-
No products found
because this supplier's products are not listed.
Coralie Berthoux, et al.,
bioRxiv - Neuroscience 2021
Quote:
... Recombinant human BDNF protein was purchased from Hello Bio. Salts for making ACSF and internal solutions were purchased from Sigma-Aldrich.
-
No products found
because this supplier's products are not listed.
Xiaobo Mao, et al.,
bioRxiv - Neuroscience 2021
Quote:
... and obtained the human FLAG-APLP1(mut9) gene with a Flag tag in the N-terminal synthesized by GENEWIZ Bio ...
-
No products found
because this supplier's products are not listed.
Lyra O. Randzavola, et al.,
bioRxiv - Immunology 2022
Quote:
... HEK293-F were transfected with polyethylenimine (Polyscience Europe GmbH) at a ratio of 1:3 DNA:polyethylenimine (Tom et al. ...
-
No products found
because this supplier's products are not listed.
Susanne Hellmuth, Olaf Stemmann,
bioRxiv - Cell Biology 2024
Quote:
... raised against CAKSKAKPPKGAHVEV = Cys + amino acids 1183-1197 of the human protein) and human anti-CREST (1:1,000; hct-0100, ImmunoVision). Secondary antibodies (all 1:500) ...
-
No products found
because this supplier's products are not listed.
Evangelos Stefanidis, et al.,
bioRxiv - Bioengineering 2023
Quote:
... soluble SiRPα-Fc at saturating concentrations were immobilized on 0.4-0.6um Protein G Yellow Fluorescent Particles (PGFP-0552-5, Spherotech) at 4°C for 1h ...
-
No products found
because this supplier's products are not listed.
Tetyana Lukash, et al.,
bioRxiv - Microbiology 2020
Quote:
... of strain 181/25 was expressed as a fusion with Twin-Strep-tag (GSWSHPQFEKGGGSGGGSGGGSWSHPQFEK) from pE-SUMOpro-3 plasmid (LifeSensors Inc.) in E ...
-
No products found
because this supplier's products are not listed.
Ferdinand Roesch, et al.,
bioRxiv - Microbiology 2022
Quote:
... Virus was diluted in RPMI-1640 (Genesee Scientific) media containing 2% FBS and 10 mM HEPES ...
-
No products found
because this supplier's products are not listed.
Moonjung Jung, et al.,
bioRxiv - Molecular Biology 2019
Quote:
... or αFlag-tag (OAEA00002, Aviva Systems Biology) antibodies.
-
No products found
because this supplier's products are not listed.
Georgina S.F. Anderson, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... THE™ NWSHPQFEK Tag-biotin (Cambridge Bioscience), anti-CD69-APC (clone FN50 ...
-
No products found
because this supplier's products are not listed.
Keren Ben-Yehuda, et al.,
bioRxiv - Bioengineering 2021
Quote:
... Then, the sample was suspended in human tubal fluid (HTF, 3 mL) medium (Irvine Scientific, CA, USA) and placed on top of a 40% and 80% silicon bead gradient and centrifuged for 20 min at 1750 rpm ...
-
No products found
because this supplier's products are not listed.
Samuele Cancellieri, et al.,
bioRxiv - Genetics 2021
Quote:
... and 100 ng ml-1 recombinant human FMS-like Tyrosine Kinase 3 Ligand (Flt3-L) (CellGenix cat# 1415-050). HSPCs were electroporated with 3xNLS-SpCas9:sg1617 RNP or HiFi-3xNLS-SpCas9:sg1617 RNP 24 h after thawing ...
-
No products found
because this supplier's products are not listed.
Martina Oravcová, et al.,
bioRxiv - Cell Biology 2022
Quote:
Endogenous level of DNA damage in HEK293 cells was evaluated using the CometAssay kit (Trevigen) according the manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Markus Hoffmann, et al.,
bioRxiv - Molecular Biology 2020
Quote:
Human TMPRSS2 (Recombinant N-terminus 6xHis, aa106-492) (Cat # LS-G57269-20) protein was acquired from LifeSpan Biosciences. Peptide Boc-Gln-Ala-Arg-MCA for the enzyme substrate was acquired from Peptide Institute ...
-
No products found
because this supplier's products are not listed.
Maria Jose Lista, et al.,
bioRxiv - Microbiology 2021
Quote:
... The relative quantities of envelope (E) gene were measured using SARS-CoV-2 (2019-nCoV) CDC qPCR Probe Assay (IDT DNA technologies). Relative quantities of E gene were normalised to GAPDH mRNA levels (Applied Bioscience ...
-
No products found
because this supplier's products are not listed.
Natalya Leneva, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... with 3 mol% of dipalmitoyl-phosphatidylinositol-3-phosphate (PI(3)P) (Echelon Biosciences) were prepared at a lipid concentration of 0.5 mg/ml in Buffer A by extrusion through a 0.4 μm polycarbonate filter (Avanti Polar Lipids) ...
-
No products found
because this supplier's products are not listed.
Nancy G. Azizian, et al.,
bioRxiv - Cancer Biology 2020
Quote:
... 5 μl of 2 mM biotin-alkyne-tag (Click Chemistry Tools, 1266), and 5 μl of 200 mM CuSO4 were added in the specified order to 5 ml of PBS (pH 7.8) ...
-
No products found
because this supplier's products are not listed.
Ann Schirin Mirsanaye, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... diluting 3 μl of protein sample (20 nM) in 15 μl PBS buffer loaded on a gasket (Grace Bio-Labs reusable CultureWell gaskets (GBL103250 ...
-
No products found
because this supplier's products are not listed.
Yueyuan Shi, et al.,
bioRxiv - Microbiology 2021
Quote:
... All cells were supplemented with 10% (v/v) fetal calf serum (FCS) (ABI) at 37 °C in 5% CO2 ...
-
No products found
because this supplier's products are not listed.
Emilie L. Cerezo, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... Human EGF (Euromedex, Cat# HC88823), LJH685 (Selleck Chemicals ...
-
No products found
because this supplier's products are not listed.
Marcin Poreba, et al.,
bioRxiv - Biochemistry 2019
Quote:
... Fluorescent tags (Cyanine-5 NHS and Cyanine-7 NHS) were purchased from Lumiprobe (Hannover, Germany). Diazomethane was generated according to the Aldrich Technical Bulletin (AL-180 ...
-
No products found
because this supplier's products are not listed.
Yoshiaki Nishimura, et al.,
bioRxiv - Microbiology 2020
Quote:
... Cells were grown to ~90% confluency in a 96-well plate prior to addition of serially diluted virus to achieve luminescence signals of 30,000-1,000,000 (BMG Labtech PolarStar Optima plate reader at maximum gain) ...
-
No products found
because this supplier's products are not listed.
Lin Zhuang, et al.,
bioRxiv - Molecular Biology 2023
Quote:
Human colon normal epithelial cells (FHC) and CRC cell lines (HT29 and LoVo ...
-
No products found
because this supplier's products are not listed.
Sherine E. Thomas, et al.,
bioRxiv - Biochemistry 2019
Quote:
... Wizard 3&4 (Molecular Dimensions), JCSG +Suite (Molecular Dimensions) ...
-
No products found
because this supplier's products are not listed.
M. Julhasur Rahman, et al.,
bioRxiv - Microbiology 2021
Quote:
The mCherry-E3L integration sites in the purified HGT virus genomes were located by inverse PCR amplification and by PacBio sequencing ...
-
No products found
because this supplier's products are not listed.
Joelle P. Straehla, et al.,
bioRxiv - Bioengineering 2021
Quote:
Human iPS-ECs (Fujifilm Cellular Dynamics, 11713), human brain PCs and ACs (ScienCell) ...
-
No products found
because this supplier's products are not listed.
Rebecca J. Edgar, et al.,
bioRxiv - Microbiology 2019
Quote:
... 32 using the AmpliteTM Fluorimetric sn-Glycerol-3-Phosphate (Gro-3-P) Assay Kit (AAT Bioquest). GAC was released from cell wall by sequential digestion with mutanolysin hydrolase and PlyC amidase ...
-
No products found
because this supplier's products are not listed.
Subhas C. Bera, et al.,
bioRxiv - Biophysics 2021
Quote:
... Model 3 includes dissociation from RPI and is solved in the context of three assumptions for which we have an analytical solution ...
-
No products found
because this supplier's products are not listed.
Jianfang Li, et al.,
bioRxiv - Developmental Biology 2021
Quote:
... Human C-peptide levels in isolated plasma were quantified using the STELLUX Chemi Human C-peptide ELISA kit (ALPCO Diagnostics) according to the manufacturer’s instructions.
-
No products found
because this supplier's products are not listed.
Herman KH Fung, et al.,
bioRxiv - Cell Biology 2022
Quote:
... Confocal volume estimation was carried out by ten 1-min FCS measurements of 10 nM Atto488 (ATTO-TEC) in water ...
-
No products found
because this supplier's products are not listed.
Roland Á. Takács, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... and 3% bovine serum albumin (BSA) (Amresco, VWR ...
-
No products found
because this supplier's products are not listed.
Brandon S. Johnson, et al.,
bioRxiv - Plant Biology 2023
Quote:
... and a 3 hr Solusol (National Diagnostics) digestion to dissolve the cell wall fraction ...
-
With the RapidClean protein removal kit, completely remove protein from aqueous solutions of...
Cat# K-01001-010,
10 reactions, USD $145.00/ea
Ask
Ethan L. Morgan, et al.,
bioRxiv - Microbiology 2020
Quote:
... Proteins were detected using WesternBright ECL (Advansta, USA) and visualised on X-ray film.
-
No products found
because this supplier's products are not listed.
Alexander B. Coley, et al.,
bioRxiv - Cancer Biology 2021
Quote:
Human embryonic kidney (HEK293) cell line was obtained from GenLantis (San Diego, CA) and cultured in MEM (Mediatech ...
-
No products found
because this supplier's products are not listed.
Bjoern Traenkle, et al.,
bioRxiv - Immunology 2021
Quote:
... an alpaca (Vicugna pacos) was immunized with the purified extracellular domains of human CD4 (aa26-390) recombinantly produced in HEK293 cells (antibodies-online GmbH, Germany). After initial priming with 1 mg ...
-
No products found
because this supplier's products are not listed.
Grant M. Zane, et al.,
bioRxiv - Microbiology 2022
Quote:
AAV4 (and AAV5) VLP preparations were validated using the serotype-specific monoclonal antibodies ADK4 (Progen, 610147) and ADK5b (Origene ...
-
No products found
because this supplier's products are not listed.
Luis Alfonso Yañez Guerra, Meet Zandawala,
bioRxiv - Evolutionary Biology 2023
Quote:
... HEK293-G5a (Angio-proteomie CAT no. cAP0200GFP-AEQ-Cyto) cells were cultured in 96 well-plates containing 100μl of DMEM (Thermo ...
-
VitroCol® is a 3 mg/ml, type I human atelocollagen solution for 2D and 3D cell culture, or as a...
Cat# 5007-100ML,
100 mL, USD $1400.0
Ask
Lauren J. Lahey, et al.,
bioRxiv - Biochemistry 2020
Quote:
HEK293 cell lines were seeded in PurCol-coated (Advanced BioMatrix) 6-well plates at 300,000 total cells in 2 mL media one day before transfection ...
-
No products found
because this supplier's products are not listed.
Jaganathan Subramani, et al.,
bioRxiv - Microbiology 2021
Quote:
... or RBD-C tag (Dyadic International, Jupiter, FL) or different variants of spike protein B.1.1.7 (Alpha; Cube Biotech # 28718), B.1.351 (Beta ...
-
No products found
because this supplier's products are not listed.
Saejeong Park, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... HEK293 cells were washed with PBS and lysed in NP-40 lysis buffer (Boston Bioproducts) including protease and phosphatase inhibitor (Roche) ...
-
No products found
because this supplier's products are not listed.
Md. Golam Kibria, et al.,
bioRxiv - Biophysics 2022
Quote:
... 200 μL of protein samples in a 3-mm optical path length quartz cuvette (T-507, TOSOH, Japan) was used for the measurements ...
-
No products found
because this supplier's products are not listed.
Indira Wu, Hee Shin Kim, Tuval Ben-Yehezkel,
bioRxiv - Genomics 2019
Quote:
... while human liver total RNA and human blood total RNA were purchased from Zyagen. LoopSeq Transcriptome kit was obtained from Loop Genomics ...
-
No products found
because this supplier's products are not listed.
Alan Bush, et al.,
bioRxiv - Neuroscience 2021
Quote:
... strips with 54 or 63 contacts each (platinum 1 mm disc contacts arranged in a 3×18 or 3×21 layout, with 3 mm center to center spacing, PMT Cortac Strips models 2110-54-001 and 2011-63-002 ...
-
No products found
because this supplier's products are not listed.
Emilia Neuwirt, et al.,
bioRxiv - Immunology 2022
Quote:
... 3 - 5 μM MCC950 (Adipogen), 50 - 200 nM MG132 (Sigma) ...
-
No products found
because this supplier's products are not listed.
Matthew D. J. Dicks, et al.,
bioRxiv - Bioengineering 2022
Quote:
... Human coagulation Factor X (hFX) (Haematologic Technologies) was added to diluted vectors at a final concentration of 8 μg/mL ...
-
No products found
because this supplier's products are not listed.
Lars Gruber, et al.,
bioRxiv - Biochemistry 2023
Quote:
Monoculture and biculture spheroids of CCD-1137Sk human fibroblasts and HT-29 human colon cancer cells (both LGC Standards, Wesel, Germany) were prepared ...
-
No products found
because this supplier's products are not listed.
Linlin You, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... coli TTC-pause at 13 mg/mL was incubated with 3-([3-cholamidopropyl] dimethylammonio)-2-hydroxy-1-propanesulfonate (CHAPSO, 8 mM, final concentration; Hampton Research Inc.) prior to grid preparation ...
-
No products found
because this supplier's products are not listed.
Basel M. Al-Barghouthi, et al.,
bioRxiv - Genetics 2021
Quote:
... high protein diet (5% fat and 20.3% protein) (D12109C and D12083101, respectively, Research Diets, New Brunswick, NJ), and were euthanized and analyzed at 24–25 weeks of age ...
-
No products found
because this supplier's products are not listed.
Seren Hamsici, Gokhan Gunay, Handan Acar,
bioRxiv - Bioengineering 2022
Quote:
... Fmoc protected amino acids (Gyros Protein Technologies) were removed through treatment with 20% piperidine/DMF solution for 45 min (three times for 15 min ...