-
No products found
because this supplier's products are not listed.
Amy L. Han, et al.,
bioRxiv - Molecular Biology 2022
Quote:
Cells were collected 1 hour after E2 (10−12 M, 10−10 M, 10−8 M) or ethanol (ETOH) (Decon Labs, Inc.) treatment after being EWD for 72 hours ...
-
No products found
because this supplier's products are not listed.
Lihua Ye, et al.,
bioRxiv - Physiology 2020
Quote:
... IAAld (m/z 159, Ambeed), IEt (m/z 161 ...
-
No products found
because this supplier's products are not listed.
Ly Porosk, et al.,
bioRxiv - Biochemistry 2022
Quote:
... Peptide-based transfection reagent Reagent007 from Icosagen suitable for suspension cells ...
-
No products found
because this supplier's products are not listed.
Hironobu Endo, et al.,
bioRxiv - Neuroscience 2023
Quote:
... 4.50-4.40 (m, 1H), 4.12-4.00 (m, 3H), 2.81 (d, J = 4.6 Hz, 3H)) were custom-synthesized (Nard Institute). NMR spectra were obtained on a JEOL ECS-400 spectrometer at 400 MHz ...
-
No products found
because this supplier's products are not listed.
Tommaso Montecchi, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... SEB and SEE peptides (2μg/ml) (Toxin Technology) or 1% BSA for controls ...
-
No products found
because this supplier's products are not listed.
Rick G. Kim, et al.,
bioRxiv - Plant Biology 2024
Quote:
... Biotinylated peptides were searched using exogenous biotin (ExBio) on lysine as a variable modification ...
-
No products found
because this supplier's products are not listed.
Maia Brunstein, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Semrock) and detected by a photomultiplier tube (GaAsP PMT, PMT2101/M, Thorlabs, and Multialkali PMT, PMT1001/M, Thorlabs). In order to find the region of interest on the focal plane ...
-
No products found
because this supplier's products are not listed.
Ciro Maurizio Amato, et al.,
bioRxiv - Developmental Biology 2023
Quote:
Dihydrotestosterone (10-4 M) (Steraloids A2570-011) or Laptinib (1µM ...
-
No products found
because this supplier's products are not listed.
Matthew J. Foulkes, et al.,
bioRxiv - Immunology 2019
Quote:
... The c-Jun N-terminal kinase inhibitor SP600125 was obtained from StressMarq Biosciences (Victoria, Canada), and tanshinone IIA (TIIA ...
-
No products found
because this supplier's products are not listed.
Shiho Yasue, et al.,
bioRxiv - Cell Biology 2023
Quote:
... USA) or 30 ng/ml MAPK kinase (MEK) inhibitor (trametinib; ChemScene, Monmouth Junction, NJ, USA) was added to these cells for examination of drug inhibition.
-
No products found
because this supplier's products are not listed.
Kamyab Javanmardi, et al.,
bioRxiv - Biochemistry 2021
Quote:
... Membranes were blocked in LICOR Odyssey Blocking Buffer (Neta Scientific) incubated with the following primary antibodies overnight ...
-
No products found
because this supplier's products are not listed.
Jessica B. Blackburn, et al.,
bioRxiv - Cell Biology 2021
Quote:
... 25 μg of SIgA was incubated with 10 μg sputum-derived human neutrophil elastase (1 ug/uL in 0.05 M NaOAc pH 5 containing 0.1 M NaCl, Elastin Products Company, SE563GI) with or without a protease inhibitor (Sigma ...
-
No products found
because this supplier's products are not listed.
Blanca Figuerola, et al.,
bioRxiv - Paleontology 2021
Quote:
... 10 m and approximately 20 m throughout Almirante Bay using a YSI multiparameter sonde (YSI EXO2 & EXO optical DO Smart Sensor) on 26 September 2017 at 83 sites (Fig ...
-
No products found
because this supplier's products are not listed.
Emily Tubbs, et al.,
bioRxiv - Bioengineering 2024
Quote:
... The cells were permeabilized by a blocking buffer containing FBS (ScienCell Research Laboratories ...
-
Atrial Natriuretic Peptide ( ANP ) ELISA / Assay Kit
Cat# K071-H1,
1.0 ea, USD $385.0
Ask
Soon Yew Tang, et al.,
bioRxiv - Pharmacology and Toxicology 2020
Quote:
Atrial natriuretic peptide (Arbor Assays, K026-H1, Ann Arbor, MI), total nitrate+nitrite (Cayman Chemical ...
-
No products found
because this supplier's products are not listed.
Laura Niederstaetter, et al.,
bioRxiv - Cell Biology 2020
Quote:
... using Moxi Z Type M Cassettes (ORFLO Technologies, USA) and the number of seeded cells for the experiments calculated based of these results ...
-
No products found
because this supplier's products are not listed.
Breanna Q. Shen, et al.,
bioRxiv - Neuroscience 2022
Quote:
Slides were incubated with blocking buffer (10% Normal Goat Serum, Atlanta Biologicals, Cat #S13150h ...
-
No products found
because this supplier's products are not listed.
Samir M. Abdelmagid, et al.,
bioRxiv - Cell Biology 2020
Quote:
The MicroVue™ Helical Peptide EIA kit (Quidel, San Diego, CA) was used to measure the level of a helical peptide containing the residues 620-633 of the type I collagen α1 chain or more formally carboxy-terminal collagen crosslinks ...
-
No products found
because this supplier's products are not listed.
Tomoko Kawamata, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... 0.2 M sorbitol using a Gradient Master (BioComp Instruments, Inc.). Before loading ...
-
No products found
because this supplier's products are not listed.
Gurman Kaur, et al.,
bioRxiv - Immunology 2021
Quote:
... and 2.8 µl of 1 M Trehalose (Life Sciences Advanced Technologies), followed by incubation at 72°C for 3 min and placing on ice ...
-
No products found
because this supplier's products are not listed.
Shota Ozawa, et al.,
bioRxiv - Biochemistry 2019
Quote:
Urinary albumin concentration was measured using Albuwell M (Exocell, Philadelphia, PA) or MICROFLUORAL Microalbumin Test (PROGEN ...
-
The peptide is used to block Anti-Creatine Kinase M Antibody (#CPA1238) reactivity.
Cat# CBP1238,
1 mg USD $100.0, 5 mg USD $300.0
Ask
Rafał Zdrzałek, et al.,
bioRxiv - Plant Biology 2024
Quote:
... membranes were incubated with appropriate antibodies diluted in blocking buffer (α-FLAG: Cohesion Biosciences, at 1:3000 dilution ...
-
No products found
because this supplier's products are not listed.
Marc Sunden, et al.,
bioRxiv - Biochemistry 2023
Quote:
A peptide (NH2-KKKYPGGSTPVSSANMM-COOH) containing an O-GlcNAcylation site of human Casein kinase II subunit alpha (underlined sequence) was custom synthesized by Nordic BioSite. A mixture of 6 mM glutaraldehyde ...
-
No products found
because this supplier's products are not listed.
Ning Zhou, et al.,
bioRxiv - Plant Biology 2024
Quote:
... The kinase reaction was quenched by adding SDS-PAGE loading buffer and then the NFR1, NFR1Y429F, and NFR1T481A kinase activities were analyzed using the anti-pTyr (GeneScript, CAT.A01819) or anti-pSer/Thr (ECM Biosciences, CAT.PP2551) antibodies ...
-
creatine kinase M-type Antibody is a Goat Polyclonal antibody against creatine kinase M-type.
Cat# abx431167-200UL,
200 µl USD $449.5
Ask
Daniel C. Levine, et al.,
bioRxiv - Neuroscience 2024
Quote:
... hypothalamus from PER2-TgWT mice that were fasted for 16 hours or given ad libitum access to HFD for 1 week was excised at ZT16 and extracted with ∼5 volumes of strong RIPA buffer containing kinase and phosphatase inhibitors (Abbexa abx090624), sonicated in a water bath 3 x 30sec on high ...
-
No products found
because this supplier's products are not listed.
Xiaona Chen, et al.,
bioRxiv - Cell Biology 2020
Quote:
... gastrocnemius and quadriceps muscles were injected with CTX (Latoxan; 10−5 M). At the indicated time points (3- and 7-day post injury) ...
-
No products found
because this supplier's products are not listed.
Jugal Mohapatra, et al.,
bioRxiv - Biochemistry 2021
Quote:
... in DMF supplemented with 0.1 M 1-hydroxybenzotriazole hydrate (HOBt, Oakwood Chemical) at 90 °C for 1 minute while bubbling with nitrogen gas ...
-
No products found
because this supplier's products are not listed.
Tobias Nöbauer, et al.,
bioRxiv - Neuroscience 2023
Quote:
... and meloxicam-containing (0.125 mg/tablet) food supplements (Bio-Serv #MD275-M). After surgery ...
-
No products found
because this supplier's products are not listed.
Lydia Zhang, et al.,
bioRxiv - Biochemistry 2023
Quote:
... Peptides were diluted in water and acidified with 1.2M formic acid (Thomas Scientific, A11750) in preparation for mass spectrometry analysis.
-
No products found
because this supplier's products are not listed.
S. M. Nayeemul Bari, et al.,
bioRxiv - Microbiology 2021
Quote:
... single stranded DNA substrates were labeled on their 5’-ends by incubating with T4 polynucleotide kinase and γ-[32P]-ATP and purified over a G25 column (IBI Scientific). Radiolabeled substrates were combined with 7.5 µl of each protein fraction ...
-
No products found
because this supplier's products are not listed.
Kristina Haase, et al.,
bioRxiv - Bioengineering 2021
Quote:
... the fibrin gel dissolved using a combination of 10% (25mg/mL) Natto Kinase (Japan Biosciences Ltd.) and 10%Accutase (Innovative Cell Technologies) in PBS ...
-
No products found
because this supplier's products are not listed.
Scarlett J Barker, et al.,
bioRxiv - Neuroscience 2023
Quote:
... 5-Ethylthio-1H-tetrazole (ETT, Honeywell Research Chemicals, 0.25 M solution in acetonitrile) was used as an activator ...
-
No products found
because this supplier's products are not listed.
Qingxia Zhao, et al.,
bioRxiv - Immunology 2021
Quote:
... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.
-
No products found
because this supplier's products are not listed.
Maria Alexandra Rujano, et al.,
bioRxiv - Developmental Biology 2021
Quote:
... S (red) and G2/M CG nuclei was performed in Volocity 6.3 (Quorum technologies).
-
No products found
because this supplier's products are not listed.
Roni Sverdlov Arzi, et al.,
bioRxiv - Bioengineering 2022
Quote:
... M-CL and H-CL mucin hydrogels was measured using pore analyzer (Micromeritics TriStar II 3020 ...
-
This antibody is a recombinant mouse monoclonal antibody which specifically reacts with human...
Cat# MOB-0044MZ,
Inquiry
Ask
Haizhang Chen, et al.,
bioRxiv - Immunology 2020
Quote:
... Recombinant CD20 was obtained as a peptide (aa141-188) containing the binding region of rituximab (Creative Biolabs). FcγR-specific mAbs were obtained from Stem Cell technologies (CD16 ...
-
No products found
because this supplier's products are not listed.
Nikolas Nikolaou, et al.,
bioRxiv - Neuroscience 2020
Quote:
... This was removed and coverslips were incubated with fresh blocking solution containing anti-GFP 1:1000 (Torrey Pines Biolabs-TP401) and anti-SNRNP70 1:200 (Sigma-AV40276 ...
-
No products found
because this supplier's products are not listed.
Andrew T. Phillips, et al.,
bioRxiv - Cell Biology 2022
Quote:
... Wells were then washed 4 times with TBST and then incubated in 1x Blocking Buffer in PBS with a 1:10,000 dilutions of either β1- (Assay Biotechnology; San Francisco ...
-
No products found
because this supplier's products are not listed.
Sylvain Perriot, et al.,
bioRxiv - Immunology 2024
Quote:
... transfected Jurkat cells and co-culture with HLA-unenhanced neurons or in presence of a blocking anti-HLA ABC antibody (W6/32, AffinityImmuno). Luminescence was measured with a Multimode Microplate Reader (BioTek Synergy) ...
-
No products found
because this supplier's products are not listed.
Zahra Hosseinzadeh, et al.,
bioRxiv - Bioengineering 2023
Quote:
... The insulin of each sample was measured with the C-Peptide & Insulin AccuBind VAST ELISA Kits (Monobind Inc., USA). Three independent experiments were performed for each group ...
-
No products found
because this supplier's products are not listed.
Alexander A. Choi, Limin Xiang, Wan Li, Ke Xu,
bioRxiv - Biophysics 2023
Quote:
... the coverslips were functionalized with 10 mg/mL methoxy PEG silane (5 kDa, M-SLN-5000, JenKem Technology) in 95% ethanol/water for 30 min ...
-
No products found
because this supplier's products are not listed.
Heather Swann, et al.,
bioRxiv - Biophysics 2020
Quote:
... CA) along with 1:1000 dilution of Anti-Membrane Protein (2019-nCoV) Polyclonal Antibody (NCV-M-005, eEnzyme, Gaithersburg, MD) and then immunoprobed with appropriate infrared secondary antibody ...
-
No products found
because this supplier's products are not listed.
Shi Min Tan, Wei-Guang Seetoh,
bioRxiv - Biochemistry 2022
Quote:
... the media in each plate was replaced with 40 μL of 1× Hank’s Balanced Salt Solution (HBSS) containing 20 mM M coelenterazine h (AAT Bioquest). The assay plate was incubated at 27 °C in the dark for 4 h ...
-
No products found
because this supplier's products are not listed.
Dana Goerzen, et al.,
bioRxiv - Neuroscience 2019
Quote:
... 16 M) were the products of F344/NHsd wild-type females bred with F344/NHsd wild-type males (010; Envigo Laboratories). All rats from both breeding schemes were genotyped using real time PCR to ensure none of the offspring for this study had incorporated the two transgenes from the TgF344-AD male breeders (Transnetyx ...
-
No products found
because this supplier's products are not listed.
Bodan Hu, et al.,
bioRxiv - Cell Biology 2019
Quote:
... The amount of M and NA segment was determined with one-step RT-qPCR using SensiFAST™ Probe Lo-ROX One-Step Kit (Bioline). The sequences of primers and probe for M segment detection are AGA TGA GYC TTC TAA CCG AGG TCG (forward primer) ...
-
No products found
because this supplier's products are not listed.
P. Lejeune, et al.,
bioRxiv - Plant Biology 2020
Quote:
... Jiffypots® with weak or abnormal plantlets were discarded and the others were transplanted into 12-cm square plastic cultivation pots filled with 1.5 L of leaf mould and baked clay (4:1) mixed with 6 gr.L−1 of slow release fertilizer (Osmocote Exact Standard 5-6 M, ICL Specialty Fertilizers). The pots were fitted at the bottom with a 2 x 10 cm felt wick and randomly placed on the deck of the cultivation gutters described above ...
-
No products found
because this supplier's products are not listed.
Hanshuang Shao, Diana Teramae, Alan Wells,
bioRxiv - Cell Biology 2022
Quote:
... Melanocytes were grown in DermaLife M media in the presence of growth factors and chemical components (Lifeline Cell Technology, Frederick, MD).
-
No products found
because this supplier's products are not listed.
Anuli C. Uzozie, et al.,
bioRxiv - Cancer Biology 2019
Quote:
Dried samples were resuspended in 0.1% TFA in 80% acetonitrile and phosphorylated peptides were purified by immobilized metal affinity chromatography (IMAC) using Fe-NTA MagBeads (Cube Biotech, Monheim, Germany). Sample solution was added to beads washed with 0.1% TFA in 80% acetonitrile ...
-
No products found
because this supplier's products are not listed.
Mahlon A. Collins, et al.,
bioRxiv - Genetics 2022
Quote:
... and resuspended in 300 µL of 1 M sorbitol containing 3 U of Zymolyase lytic enzyme (United States Biological, Salem, MA, USA) to degrade ascal walls ...
-
No products found
because this supplier's products are not listed.
Susanne Liese, et al.,
bioRxiv - Biophysics 2020
Quote:
... supplemented with DTT (0.1 M endconcentration) and then subjected to SDS-PAGE on 12% or 4–20% gradient gels (mini-PROTEAN TGX; Bio-Rad). Proteins were transferred to PVDF membranes (TransBlot® TurboTM LF PVDF ...