-
No products found
because this supplier's products are not listed.
Erin A. Mack, Yu-Ping Xiao, David R. Allred,
bioRxiv - Molecular Biology 2019
Quote:
... Defibrinated bovine blood products were obtained locally from Holstein cows (approved by University of Florida Institutional Animal Care and Use Committee, protocol #201102216) or commercially (Hemostat Laboratories; Dixon, CA). Parasite sensitivity to pyrimethamine was determined as described [51] ...
-
No products found
because this supplier's products are not listed.
Eun Jeong Lee, et al.,
bioRxiv - Neuroscience 2021
Quote:
... Plasma ACTH concentrations were measured using the ACTH ELISA kit (MD Biosciences), according to the manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Min-Young Noh, et al.,
bioRxiv - Neuroscience 2022
Quote:
... and CSF NfLs were measured with an ELISA kit (UmanDiagnostics AB, Umeå, Sweden). HC samples were collected from ALS patient spouses after obtaining consent.
-
No products found
because this supplier's products are not listed.
Tomasz Zieliński, et al.,
bioRxiv - Biophysics 2022
Quote:
... CytoGlow™ Cofilin (Phospho-Ser3) Colorimetric Cell-Based ELISA Kit was applied (Assay Biotechnology) to monitor target proteins concentration ...
-
No products found
because this supplier's products are not listed.
Jin-Ran Chen, et al.,
bioRxiv - Developmental Biology 2021
Quote:
... Serum bone resorption marker C-terminal telopeptides of type I collagen (CTX-1) was measured by Rat-LapsTM ELISA from Nordic Biosciences Diagnostic (Herlev ...
-
No products found
because this supplier's products are not listed.
Sourav Roy, et al.,
bioRxiv - Microbiology 2023
Quote:
... ELISAs specific for the lectin pathway contained single 1 μM concentrations of FbpC-C or BBK32-C incubated with 2% C1q-depleted NHS (Complement Technologies). Serum incubations were performed in complement ELISA buffer (10 mM HEPES pH 7.3 ...
-
No products found
because this supplier's products are not listed.
Lina Freage, et al.,
bioRxiv - Biochemistry 2020
Quote:
... while OSJ-T3-OMe was synthesized by using the 2’-OMe-Ac-C-CE and 2’-OMe-U-CE phosphoramidites (Glen Research) to modify the 40th and 41st bases (Glen Research) ...
-
Recombinant Antigen
Cat# REC31700-100,
100µg USD $488.0
Ask
Maya Imbrechts, et al.,
bioRxiv - Immunology 2021
Quote:
The binding of the purified recombinant antibodies to the following SARS-CoV-2 antigens was assessed via ELISA: spike glycoprotein (S1) RBD-His (REC31849-500, The Native Antigen Company), RBD(N439K)-His (40592-V08H14 ...
-
No products found
because this supplier's products are not listed.
Edward Sullivan, et al.,
bioRxiv - Microbiology 2021
Quote:
The BioSensor SARS-CoV-2 Ag Kit (Oxford Biosystems) was used in accordance with manufacturer’s instructions to process swab samples from hamsters ...
-
No products found
because this supplier's products are not listed.
Sarah M. Mohr, et al.,
bioRxiv - Physiology 2024
Quote:
... T3 concentration was measured by ELISA (Leinco Technologies, T181). Dried product was resolubilized in the zero-standard and the kit run according to the manufacturer’s instructions.
-
No products found
because this supplier's products are not listed.
Sing Teng Chua, et al.,
bioRxiv - Plant Biology 2023
Quote:
... sublimated at -90°C (2 minutes) and finally sputter coated with platinum (10 nm; Quorum Technologies Q150T ES).
-
No products found
because this supplier's products are not listed.
Measho H. Abreha, et al.,
bioRxiv - Neuroscience 2020
Quote:
... 2 mM EDTA and 0.25 mM DTT) plus 100 μM ATP for 30 min at 37°C (SignalChem, K01-09). TBK1 kinase activity was inhibited by adding 100 μM or 200 μM of BX795 (ENZ-CHM189-0005 ...
-
No products found
because this supplier's products are not listed.
Emmeline L. Blanchard, et al.,
bioRxiv - Bioengineering 2020
Quote:
... The RNA was heat denatured at 65°C for 10 minutes before capping with a Cap-1 structure using guanylyl transferase and 2’-O-methyltransferase (Aldevron). mRNA was then purified by lithium chloride precipitation ...
-
No products found
because this supplier's products are not listed.
Nijamuddin Shaikh, Karishma S Kaushik,
bioRxiv - Microbiology 2023
Quote:
... C-12302) and cultured in Fibroblast Growth Medium (FGM) containing 2% fetal bovine serum (FBS) (Cell Applications, USA 116– 500). The immortalized epidermal keratinocyte cell line (HaCaT ...
-
No products found
because this supplier's products are not listed.
Kevin M. Knox, et al.,
bioRxiv - Neuroscience 2021
Quote:
... FluoroJade-C (FJ-C; catalog #1FJC) was from Histo-Chem Inc (Jefferson ...
-
No products found
because this supplier's products are not listed.
Joakim Karlsson, et al.,
bioRxiv - Cancer Biology 2019
Quote:
... cells were surface stained for 45 min in 37°C using Melanoma Dextramer Collection 1 kit from Immudex. Dead cells were excluded from the analysis using Live/Dead Aqua (Invitrogen) ...
-
No products found
because this supplier's products are not listed.
Michael P. Doyle, et al.,
bioRxiv - Immunology 2022
Quote:
... Cell supernatants were screened by ELISA using recombinant YFV E protein (Meridian Life Sciences). Wells with positive reactivity were fused to a human-mouse myeloma cell line (HMMA 2.5 ...
-
No products found
because this supplier's products are not listed.
Ezekiel C. Thomas, Amber Ismael, Jeffrey K. Moore,
bioRxiv - Cell Biology 2020
Quote:
... and 1% yeast extract) at 30°C then diluted into synthetic media (2% glucose, CSM from Sunrise Science Products, #1001 San Francisco, CA) and grown to log phase at 30°C ...
-
No products found
because this supplier's products are not listed.
Abdoulie O. Touray, et al.,
bioRxiv - Microbiology 2023
Quote:
... Membranes were probed for 2 h at RT (or overnight at 4°C) with mAb α-V5 (BioShop Canada Inc., catalog number TAG006.100) 1:2,500 in 6% milk in PBS 0.05% Tween (PBS-T) ...
-
No products found
because this supplier's products are not listed.
Sylwia Machcinska, et al.,
bioRxiv - Developmental Biology 2020
Quote:
... and C (CELLnTEC, Switzerland) was added per insert ...
-
No products found
because this supplier's products are not listed.
Barbara Ciralli, et al.,
bioRxiv - Neuroscience 2023
Quote:
... cannabinol (Cerilliant C-046) and CBD (Cerilliant C-045 ...
-
No products found
because this supplier's products are not listed.
Gaia Calamera, et al.,
bioRxiv - Pharmacology and Toxicology 2023
Quote:
... 2 mM EDTA and lysed using Solobuffer cell lysis kit (Fabgennix, Frisco, TX 75033, US). Measurements of ATP in the samples were performed according to manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Jessica T. Stieglitz, et al.,
bioRxiv - Synthetic Biology 2022
Quote:
... 2: 2-Amino-6-(prop-2-ynoxycarbonylamino)hexanoic acid (LysAlk, AstaTech); 3 ...
-
No products found
because this supplier's products are not listed.
NV DiBenedetto, et al.,
bioRxiv - Microbiology 2023
Quote:
... The same procedure is used for the Toxin B ELISA but N4A8 monoclonal antibodies (BBI solution) diluted at 4ng/ml in PBS was used for the capture antibodies and the T4G1 monoclonal antibodies previously coupled to biotin were used as detection antibodies (BBI solution ...
-
No products found
because this supplier's products are not listed.
Benjamin Orris, et al.,
bioRxiv - Biochemistry 2022
Quote:
... 2-14C labeled 2’-deoxythymidine-5’-triphosphate (2-14C-dTTP) was obtained from Moravek biochemicals ...
-
No products found
because this supplier's products are not listed.
Ainelen Piazza, et al.,
bioRxiv - Microbiology 2022
Quote:
The quantification of c-di-GMP levels was performed using the Cyclic-di-GMP Assay Kit from Lucerna (Catalog Number: 200-100). Cultures of the strains were adjusted to OD600 = 0.2 and set up for the assay in 30-µl aliquots along with assay reagents and serially diluted c-di-GMP standards ...
-
No products found
because this supplier's products are not listed.
Thekla Cordes, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... The cell suspension was centrifuged at 20,000 g for 10 min at 4 °C and 20 µl of the supernatant was used for protein quantification using BCA protein assay kit (Cat. #G1002, Lamda Biotech. Inc) as per manufacturer’s instruction.
-
No products found
because this supplier's products are not listed.
Galit H. Frydman, et al.,
bioRxiv - Immunology 2019
Quote:
... 10 µL of cells were then imaged on a disposable C-Chip hemocytometer (In Cyto, SKC, Inc. C-Chip) using a 10X and 20X objective on a Nikon TiE fluorescent microscope ...
-
No products found
because this supplier's products are not listed.
Nicole M. Gaudelli, et al.,
bioRxiv - Genomics 2020
Quote:
... and 250IU/mL of recombinant human interleukin-2 (rhIL-2, CellGenix GmbH). Cells were activated with soluble human anti-CD3 (clone OKT3 ...
-
No products found
because this supplier's products are not listed.
Ian W. McCahill, et al.,
bioRxiv - Plant Biology 2024
Quote:
... 2 media (Caisson Labs). Aqueous solutions of paclobutrazol and GA3 were freshly prepared and diluted to 0.1 µM and 10 µM respectively in hydroponic media ...
-
No products found
because this supplier's products are not listed.
Kristoffer Krogerus, Nils Rettberg, Brian Gibson,
bioRxiv - Microbiology 2022
Quote:
... after which spores from the different parental strains were dissected and placed next to each other on YPD agar plates (1 % yeast extract, 2 % peptone, 2 % glucose, and 2 % agar) using a micromanipulator (Singer Instruments, UK). The plates were incubated at 25 °C for 3 days ...
-
No products found
because this supplier's products are not listed.
Steven Swendeman, et al.,
bioRxiv - Biochemistry 2022
Quote:
... Activated Protein C was obtained from Enzyme Research laboratories. For initial studies ...
-
No products found
because this supplier's products are not listed.
Saurav Kumar, et al.,
bioRxiv - Cell Biology 2023
Quote:
... pMD2.G and psPAX2 in 2:1:2 ratio with PolyJet transfection reagent (SignaGen Laboratories). Media were harvested two days later and added to recipient cells with 1 μg/ml polybrene (Sigma ...
-
No products found
because this supplier's products are not listed.
Owen J. Chen, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... MEFs were maintained at 37°C in DMEM (Wisent Bioproducts: 4.5 g/L glucose ...
-
No products found
because this supplier's products are not listed.
Angel K. Kongsomboonvech, et al.,
bioRxiv - Immunology 2020
Quote:
... 2% heat-inactivated FBS (Omega Scientific)] and blocked with blocking buffer [FACS buffer with 5% normal Syrian hamster serum (Jackson Immunoresearch ...
-
No products found
because this supplier's products are not listed.
Huiqiao Pan, et al.,
bioRxiv - Microbiology 2023
Quote:
... point style #2 needles (Hamilton Company) were used to inject 100 µL headspace samples into TRACE 1300/ISQ 7000 GC-MS equipped with a TracePLOT TG-BOND Q+ column (30 m x 0.32 mm x 10 µm ...
-
No products found
because this supplier's products are not listed.
Gayani Wijegunawardena, et al.,
bioRxiv - Biochemistry 2023
Quote:
... 2-chlorotrityl resin was purchased from Chempep Inc ...
-
No products found
because this supplier's products are not listed.
Linshan Sun, et al.,
bioRxiv - Neuroscience 2021
Quote:
... Primary antibodies: c-Fos (CST, #2250) and tyrosine hydroxylase (TH) (ImmunoStar, #22941). The numbers of c-Fos ...
-
No products found
because this supplier's products are not listed.
Melika Shahhosseini, et al.,
bioRxiv - Bioengineering 2022
Quote:
... supplemented with 2% heat-inactivated FBS (Atlas Biologicals), and 1mM MgCl2 ...
-
No products found
because this supplier's products are not listed.
Alexander von Appen, et al.,
bioRxiv - Cell Biology 2019
Quote:
... rat α-Tubulin (YL1/2; Accurate Chemical & Scientific), SUN1 (ab124770 ...
-
No products found
because this supplier's products are not listed.
Diego A. Vargas-Blanco, et al.,
bioRxiv - Microbiology 2019
Quote:
... transferred to 2 mL disruption tubes (OPS Diagnostics 100 μm zirconium lysing matrix ...
-
No products found
because this supplier's products are not listed.
Julia Fath, et al.,
bioRxiv - Cell Biology 2022
Quote:
... with 1 μM TAMRA-sheperdin-C-ter BDNF (TAMRA-KHSSGCAFLKKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France), or with TAMRA fluorophore alone for 20 minutes ...
-
No products found
because this supplier's products are not listed.
Alexander Sheh, et al.,
bioRxiv - Microbiology 2020
Quote:
... The cultures were incubated at 37° C in an anaerobic chamber (Coy Lab Products) with mixed gas (10% CO2 ...
-
No products found
because this supplier's products are not listed.
Mathieu Métivier, et al.,
bioRxiv - Cell Biology 2020
Quote:
... dialyzed overnight in PBS at 4°C and used for guinea pig immunization (Covalab).
-
No products found
because this supplier's products are not listed.
Quynh T. Phan, et al.,
bioRxiv - Microbiology 2021
Quote:
... Primary oral mucosal epithelial cells from BALB/c mice were obtained from Cell Biologics Inc ...
-
No products found
because this supplier's products are not listed.
Vicki Mercado-Evans, et al.,
bioRxiv - Microbiology 2023
Quote:
... were grown to stationary phase at 37°C in Todd-Hewitt broth (Hardy Diagnostics) for at least 16 h ...
-
No products found
because this supplier's products are not listed.
Sangnam Kim, Siyuan Zhang, Sangpil Yoon,
bioRxiv - Bioengineering 2021
Quote:
... add 2 ml of SoluLyse-Sodium Phosphate reagent (Genlantis) per 2 ml of pooled culture ...
-
No products found
because this supplier's products are not listed.
Yuxin Lin, et al.,
bioRxiv - Biophysics 2024
Quote:
... The sample was then positioned onto a heated stage (37 °C. Heating elements: Bioscience Tools, TC-E35 ...
-
No products found
because this supplier's products are not listed.
Cato Prince, et al.,
bioRxiv - Bioengineering 2024
Quote:
... and 2 mM MgCl2 and 200 U of mSAN nuclease (Arcticzymes catalog #70950-150). Cell lysates were incubated at 37°C for 1 hour ...
-
No products found
because this supplier's products are not listed.
Hui Zhang, et al.,
bioRxiv - Developmental Biology 2023
Quote:
... Samples were boiled at 100 °C in a metal bath for 10 min in protein loading buffer (CoWin Biosciences, Beijing, China) and equal amount proteins were separated by 10% SDS-PAGE gel ...