-
No products found
because this supplier's products are not listed.
Eric Waltari, et al.,
bioRxiv - Immunology 2019
Quote:
... Blocking solution (sciBLOCK Protein D1M solution, Scienion) was added at 200 μL/well with a multichannel pipet and allowed to incubate without agitation for 1 hour ...
-
No products found
because this supplier's products are not listed.
Sebastian Bothe, et al.,
bioRxiv - Biochemistry 2022
Quote:
One fragment (ID5) reported to bind to the N-domain [26] could be purchased from Enamine and was tested as a positive control ...
-
No products found
because this supplier's products are not listed.
Ly Porosk, et al.,
bioRxiv - Biochemistry 2022
Quote:
... Peptide-based transfection reagent Reagent007 from Icosagen suitable for suspension cells ...
-
No products found
because this supplier's products are not listed.
Shauni Doms, et al.,
bioRxiv - Genetics 2021
Quote:
... We sent DNA samples from 26 G0 mice and 320 G2 mice to GeneSeek (Neogen, Lincoln, NE) for genotyping using the Giga Mouse Universal Genotyping Array (GigaMUGA ...
-
No products found
because this supplier's products are not listed.
Tommaso Montecchi, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... SEB and SEE peptides (2μg/ml) (Toxin Technology) or 1% BSA for controls ...
-
No products found
because this supplier's products are not listed.
Rick G. Kim, et al.,
bioRxiv - Plant Biology 2024
Quote:
... Biotinylated peptides were searched using exogenous biotin (ExBio) on lysine as a variable modification ...
-
No products found
because this supplier's products are not listed.
Kenyum Bagra, et al.,
bioRxiv - Microbiology 2023
Quote:
... Biofilms were grown on rectangular glass slides of 76 x 26 mm size (DWK Life Science, Wertheim, Germany) that were mounted on Artificial Exposure Units (AEUs) ...
-
No products found
because this supplier's products are not listed.
László Imre, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Cyclodextrin/peptide complex formation was performed by mixing 30 μM peptide and 300 μM SBECD (Sulfobutylether-β-Cyclodextrin; CycloLab, Budapest, Hungary) diluted in colorless ...
-
No products found
because this supplier's products are not listed.
Kamyab Javanmardi, et al.,
bioRxiv - Biochemistry 2021
Quote:
... Membranes were blocked in LICOR Odyssey Blocking Buffer (Neta Scientific) incubated with the following primary antibodies overnight ...
-
No products found
because this supplier's products are not listed.
K. Elkie Peebles, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Ovaries were dissected in cold Schneider’s media then transferred to a glass microscope slide with a 26 x 16 x 0.15 mm spacer (iSpacer from SunJin Lab) containing 75 µl water ...
-
No products found
because this supplier's products are not listed.
Gregory A. Breuer, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... Blocking was performed in TBS-T with 5% BSA (Gold Biotechnology) for 1h at room temperature ...
-
No products found
because this supplier's products are not listed.
Emily Tubbs, et al.,
bioRxiv - Bioengineering 2024
Quote:
... The cells were permeabilized by a blocking buffer containing FBS (ScienCell Research Laboratories ...
-
Atrial Natriuretic Peptide ( ANP ) ELISA / Assay Kit
Cat# K071-H1,
1.0 ea, USD $385.0
Ask
Soon Yew Tang, et al.,
bioRxiv - Pharmacology and Toxicology 2020
Quote:
Atrial natriuretic peptide (Arbor Assays, K026-H1, Ann Arbor, MI), total nitrate+nitrite (Cayman Chemical ...
-
No products found
because this supplier's products are not listed.
Enas Abu-Shah, et al.,
bioRxiv - Immunology 2019
Quote:
Peptide loading on DC was quantified using an AlexaFluor 647 conjugated high affinity soluble TCR (c113 against NY-ESO) 26 with a known dye ratio and Quantum MESF AlexaFluor 647 beads as calibration (647, Bangs Laboratories).
-
No products found
because this supplier's products are not listed.
Leah Cuthbertson, et al.,
bioRxiv - Microbiology 2022
Quote:
... derived from a 26-year old adult were grown on collagen coated flasks using the Airway Epithelial Cell Growth Medium Kit (Promocell, Germany) supplemented with bovine pituitary extract (0.004ml/ml) ...
-
No products found
because this supplier's products are not listed.
Sajid Khan, et al.,
bioRxiv - Cancer Biology 2024
Quote:
... according to the manufacturer’s protocol and as described previously.(26, 32) The absorbance was recorded at 490Lnm using Biotek’s Synergy Neo2 multimode plate reader (Biotek, Winooski, VT). The half-maximal inhibitory concentration (IC50 ...
-
No products found
because this supplier's products are not listed.
Andrew J. Flores, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Injections were carried out at a rate of 1.0 μL per min using a 10.0 μL syringe and needle (26-gauge, 22 mm, 45°tip; Hamilton Company, Reno, NV) with a microinjector (Stoelting Co. ...
-
No products found
because this supplier's products are not listed.
Breanna Q. Shen, et al.,
bioRxiv - Neuroscience 2022
Quote:
Slides were incubated with blocking buffer (10% Normal Goat Serum, Atlanta Biologicals, Cat #S13150h ...
-
No products found
because this supplier's products are not listed.
Samir M. Abdelmagid, et al.,
bioRxiv - Cell Biology 2020
Quote:
The MicroVue™ Helical Peptide EIA kit (Quidel, San Diego, CA) was used to measure the level of a helical peptide containing the residues 620-633 of the type I collagen α1 chain or more formally carboxy-terminal collagen crosslinks ...
-
No products found
because this supplier's products are not listed.
Francesco Caiazza, et al.,
bioRxiv - Cancer Biology 2019
Quote:
... and peptides desalted with C18 Desalting Tips (Rainin, Oakland, CA, USA), lyophilized ...
-
No products found
because this supplier's products are not listed.
Isidoro Cobo, et al.,
bioRxiv - Cell Biology 2021
Quote:
... The purified 40 μl of dsDNA was end-repaired by blunting followed by A-tailing and adapter ligation as described elsewhere (26) using BIOO Barcodes (BIOO Scientific, #514104), IDT TruSeq Unique Dual Indexes or Kapa Unique Dual-Indexed Adapters using 15 μl Rapid Ligation Buffer (Enzymatics ...
-
No products found
because this supplier's products are not listed.
Sunil Yeruva, et al.,
bioRxiv - Cell Biology 2023
Quote:
Atomic Force Microscopy measurements were performed as described before 26, 50 using a Nanowizard® III AFM (JPK Instruments, Berlin, Germany) with an optical fluorescence microscope (Axio Observer D1, Carl Zeiss) at 37°C ...
-
No products found
because this supplier's products are not listed.
Natasha D. Durham, et al.,
bioRxiv - Microbiology 2019
Quote:
... 300 µl 1% BSA in PBS blocking buffer (Cat# B0101; Teknova, Hollister, CA) was added for 1 h either at room temperature (RT ...
-
No products found
because this supplier's products are not listed.
Joshua Johnson, et al.,
bioRxiv - Physiology 2020
Quote:
... Endogenous peroxidase blocking was performed by using 3% hydrogen peroxide (Labchem, Cat # LC154301). Sections were then washed in water ...
-
No products found
because this supplier's products are not listed.
Pau Yen Wu, et al.,
bioRxiv - Neuroscience 2019
Quote:
... were implanted into the left and right abdominal muscle using a 26-gauge needle and the free ends were attached to a differential amplifier (Model 1700, A-M Systems, Sequim, WA). A 24-gauge angiocatheter (EXELINT ...
-
No products found
because this supplier's products are not listed.
Xiaoyue Zhu, et al.,
bioRxiv - Neuroscience 2022
Quote:
All 8 rats were implanted bilaterally in FOF (+2 AP, ±1.5 ML mm from Bregma) with 26 AWG guide cannulae (RWD Life Science Co.,LTD, Shenzhen) and in lateral PPC (−3.8 AP ...
-
No products found
because this supplier's products are not listed.
M.F. Lefebvre, et al.,
bioRxiv - Developmental Biology 2022
Quote:
Images recorded by the lightsheet microscope were registered based on the position of fiduciary beads embedded in the agarose (Fluoresbrite multifluorescent 0.5-μm beads 24054, Polysciences Inc., as described in Ref. [26]) using the Multiview reconstruction plugin [40] in Fiji [41] ...
-
No products found
because this supplier's products are not listed.
Tyson J. Ruetz, et al.,
bioRxiv - Neuroscience 2021
Quote:
... Slides were treated with 50-70 µL blocking solution (5% normal donkey serum [NDS, ImmunoReagents, SP-072-V×10] ...
-
No products found
because this supplier's products are not listed.
Mark J. Wall, et al.,
bioRxiv - Physiology 2020
Quote:
... Peptides for interfering with G protein signalling were obtained from Hello Bio (Bristol, UK) and were based on published sequences16 ...
-
No products found
because this supplier's products are not listed.
Anne-Sophie Hafner, et al.,
bioRxiv - Neuroscience 2019
Quote:
... After 30 min in blocking buffer cells were incubated with mouse anti-puromycin (Kerafast, 1:2000) for 1 h at room temperature ...
-
No products found
because this supplier's products are not listed.
Linda Balabanian, et al.,
bioRxiv - Biophysics 2021
Quote:
... Cells were then washed with Blocking Buffer: 2% (w/v) BSA (BioShop Canada Inc., Burlington, ON), 0.2% (w/v ...
-
No products found
because this supplier's products are not listed.
Qingxia Zhao, et al.,
bioRxiv - Immunology 2021
Quote:
... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.
-
No products found
because this supplier's products are not listed.
Peter Verstraelen, et al.,
bioRxiv - Neuroscience 2022
Quote:
... Permeabilization was done in blocking buffer (0.1% bovine serum albumin, 10% normal horse serum (Innovative Research IGHSSER) in PBS ...
-
No products found
because this supplier's products are not listed.
Chiara Aloise, et al.,
bioRxiv - Microbiology 2023
Quote:
... The cells were then incubated in blocking buffer containing mouse anti-dsRNA (1:1000; English & Scientific Consulting), goat anti-eIF3η (1:200 ...
-
No products found
because this supplier's products are not listed.
Ji-Hoon Lee, et al.,
bioRxiv - Bioengineering 2024
Quote:
... incubated with primary antibody against spike protein diluted 1:5,000 in blocking buffer (Elabscience, E-AB-V1006) overnight in a 37°C incubator with 5% CO2 injection ...
-
No products found
because this supplier's products are not listed.
Krista K. Alexander, et al.,
bioRxiv - Biochemistry 2023
Quote:
Peptides were diluted in water and were analyzed using a 1.00 mm QS cuvette (Starna Cells). A JASCO J-710 circular dichroism spectrometer and JASCO Spectra Manager software were used to analyze the results using the following parameters ...
-
No products found
because this supplier's products are not listed.
The Nhu Nguyen, et al.,
bioRxiv - Microbiology 2023
Quote:
Antibody responses against IAV-S nucleoprotein (NP) were measured by using a commercial blocking ELISA (IDEXX, Montpellier, France), following the manufacturer’s recommendation ...
-
No products found
because this supplier's products are not listed.
Lei Wang, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... anti-human CD25-PE-Cy7 (clone MA251) plus FVD-eFluor-780 (eBioscience) and human FcR blocking Reagent (StemCell Technologies). Cells were washed then fixed and permeabilized using the eBioscience FOXP3/Transcription Factor Staining Buffer Set ...
-
No products found
because this supplier's products are not listed.
Justin M. Westerfield, et al.,
bioRxiv - Biophysics 2021
Quote:
... peptides were added to a saturated solution of α-cyano-4-hydroxy-cinnamic acid (TCI America, Portland, OR) in 70% acetonitrile (Fisher Chemical ...
-
No products found
because this supplier's products are not listed.
Nikolas Nikolaou, et al.,
bioRxiv - Neuroscience 2020
Quote:
... This was removed and coverslips were incubated with fresh blocking solution containing anti-GFP 1:1000 (Torrey Pines Biolabs-TP401) and anti-SNRNP70 1:200 (Sigma-AV40276 ...
-
No products found
because this supplier's products are not listed.
Colton D. Payne, et al.,
bioRxiv - Biochemistry 2020
Quote:
... The resin used as an anchor for peptide assembly was Tentagel XV 4-hydroxymethyl phenoxyacetic acid (Rapp Polymere, GmbH). Prior to the loading of the C-terminal residue ...
-
No products found
because this supplier's products are not listed.
Jhansi L. Leslie, et al.,
bioRxiv - Microbiology 2019
Quote:
... each plate had a positive control consisting of toxin coated wells reacted with mouse TcdA monoclonal antibody TGC2 diluted 1:5,000 in blocking buffer (antibodies-online.com ABIN335169). The optical density at 410nm and 650nm was recorded on a VersaMax plate reader (Molecular Devices ...
-
No products found
because this supplier's products are not listed.
Takafumi Kato, et al.,
bioRxiv - Pathology 2021
Quote:
... PRR4 cDNA without a signal peptide sequence (corresponding to amino acids 17 to 134) was cloned into the pM-secSUMOstar Vector (7121, LifeSensors). SUMOstar-PRR4 vectors were transfected into Expi293 cells (1 mg of DNA per liter of transfection ...
-
No products found
because this supplier's products are not listed.
Marco Tognetti, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... the sample’s peptide concentrations were determined using a UV/VIS Spectrometer at 280 nm/430 nm (SPECTROstar Nano, BMG Labtech) and centrifuged at 14,000 × g at 4 °C for 30 min.
-
No products found
because this supplier's products are not listed.
Michela Carlet, et al.,
bioRxiv - Cancer Biology 2020
Quote:
... using a 5’ primer carrying NsiI and a 3’ primer carrying P2A-NsiI and ligated into the NsiI digested pCDH-SFFV-GLuc-T2A-mCherry vector downstream of the T2A peptide (Figure S2a) (pCDH-vector, System Bioscience). For inducible knockdown of target genes ...
-
No products found
because this supplier's products are not listed.
Zuriñe Antón, et al.,
bioRxiv - Cell Biology 2021
Quote:
... The DPC-bound peptide sample was prepared by dissolving lyophilized peptide in PBS supplemented with 7% D2O with 0.7% perdeuterated d38-DPC (Cambridge Isotope Laboratories) at a final concentration of ~ 2 mM ...
-
No products found
because this supplier's products are not listed.
Toshiharu Ichinose, et al.,
bioRxiv - Neuroscience 2024
Quote:
... The ribosome-bound mRNA was eluted with 50 µl of 100 µg/ml 3× FLAG peptide (GEN-3XFLAG- 25, Protein Ark) dissolved in the lysis buffer.
-
No products found
because this supplier's products are not listed.
Anuli C. Uzozie, et al.,
bioRxiv - Cancer Biology 2019
Quote:
Dried samples were resuspended in 0.1% TFA in 80% acetonitrile and phosphorylated peptides were purified by immobilized metal affinity chromatography (IMAC) using Fe-NTA MagBeads (Cube Biotech, Monheim, Germany). Sample solution was added to beads washed with 0.1% TFA in 80% acetonitrile ...
-
No products found
because this supplier's products are not listed.
Fenghui Zhao, et al.,
bioRxiv - Molecular Biology 2021
Quote:
The purified peptide 20–GLP-1R–Gs–Nb35 complex (3.5 μL) was applied to glow-discharged holey carbon grids (Quantifoil R1.2/1.3, 300 mesh), and subsequently vitrified using a Vitrobot Mark IV (ThermoFisher Scientific ...
-
No products found
because this supplier's products are not listed.
Akesh Sinha, et al.,
bioRxiv - Immunology 2024
Quote:
... peptide (YPYDVPDYAGAGC) or N-terminally biotinylated HA peptide (Bio-HA) (GL Biochem Ltd., Shanghai, China) or HER2 extracellular domain (ECD) (Acrobiosystems, Newark, DE, USA) was used as antigen in ELISAs ...