-
No products found
because this supplier's products are not listed.
Jessica L. Terrell, et al.,
bioRxiv - Synthetic Biology 2020
Quote:
... A coiled platinum wire (BaSi) with surface area larger than that of the working electrode was used as the counter electrode ...
-
Cat# P1112,
USD $349.0/500.0µg
Ask
Tri Komala Sari, et al.,
bioRxiv - Microbiology 2019
Quote:
... and H1817 (domain VI) were from Virusys. Anti-gB monoclonal antibodies DL16 (oligomer-specific ...
-
This product is a 42.4 kDa Human CHCHD4 membrane protein expressed in In vitro wheat germ...
Cat# MP0214X,
1.0 case, Inquiry
Ask
Mohammad Barghouth, et al.,
bioRxiv - Physiology 2022
Quote:
Anti-insulin VHH Single Domain Antibody tagged with biotin was purchased from Creative Biolabs (Cat# NAB-1554-VHH); guinea pig primary IgG anti-insulin antibody from EuroDiagnostica (B65-1) ...
-
No products found
Trinh Phan-Canh, et al.,
bioRxiv - Microbiology 2020
Quote:
... containing SafeView (ABM), and UV visualization were performed on Gel Documentation System WGD-30 (DAIHAN Scientific Korean) ...
-
No products found
because this supplier's products are not listed.
Ronald McGregor, et al.,
bioRxiv - Neuroscience 2023
Quote:
... and incubated for 72 hours at 4°C in a PBST solution containing rabbit anti-Hcrt-1 primary antibody (1:10000, H-003-30, Lot # 01108, Phoenix Pharmaceuticals Inc.) or rabbit anti-MCH (1:20000 ...
-
No products found
because this supplier's products are not listed.
Katherine A. Sharp, et al.,
bioRxiv - Cell Biology 2021
Quote:
... containing 1% Pen/Strep (Caisson Labs), 10% FBS (Gibco) ...
-
No products found
because this supplier's products are not listed.
Thomas Jungas, et al.,
bioRxiv - Developmental Biology 2020
Quote:
... containing 30 % glucose (cat# UG3050, Euromedex) and 5 ng/ml FGF (cta# S029 ...
-
No products found
because this supplier's products are not listed.
Lucas A. Meirelles, Dianne K. Newman,
bioRxiv - Microbiology 2021
Quote:
... ceftazidime (TCI, containing ca. 10% Na2CO3), chloramphenicol (Sigma-Aldrich) ...
-
No products found
because this supplier's products are not listed.
Marissa Lindman, et al.,
bioRxiv - Immunology 2023
Quote:
... containing prewarmed Neuronal Medium (ScienCell, #1521) following manufacturer recommendations and used for experiments 6 DIV.
-
No products found
because this supplier's products are not listed.
Carla E. M. Golden, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Dox-containing food (Bio-Serv diet) was available ad lib and dox-containing water ( 3 mg/mL Sigma-Aldrich dox powder ...
-
No products found
because this supplier's products are not listed.
Roland Thuenauer, et al.,
bioRxiv - Microbiology 2022
Quote:
... was incubated with a solution containing streptavidin-coated polystyrene beads containing the dye Flash red with 1 µm diameter (Bangs Laboratories). To ensure homogenous coverage with LecB-biotin ...
-
No products found
Thomas Fischer, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... containing proteinase inhibitor an phosphatase inhibitor (1/100; Bimake) by sonication using Branson Sonifier 150 with a duty cycle at 25% ...
-
No products found
because this supplier's products are not listed.
Neal I. Callaghan, et al.,
bioRxiv - Bioengineering 2022
Quote:
... containing 5 μmol L−1 S-blebbistatin (Toronto Research Chemicals) to prevent movement artifact.
-
No products found
because this supplier's products are not listed.
Krzysztof Kuś, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... and secondary antibody (AF488-conjugated goat anti-mouse antibody /Elabscience/). Cells in PBS were mounted on poly-lysine-treated coverslips (18mmx18mm ...
-
No products found
because this supplier's products are not listed.
Chenju Yi, et al.,
bioRxiv - Neuroscience 2020
Quote:
... GT15057 antibody (Neuromics) against the receptor extracellular domain was used instead ...
-
No products found
because this supplier's products are not listed.
Maoxiang Guo, et al.,
bioRxiv - Bioengineering 2020
Quote:
... Streptavidin gold nanoparticle solution containing 10 nm diameter particles was purchased from BBI Solutions Company ...
-
No products found
because this supplier's products are not listed.
Feipeng Chen, Yaojun Zhang, Ho Cheung Shum,
bioRxiv - Biophysics 2023
Quote:
... 5 μL samples containing complex coacervates was loaded onto the grids (Ted Pella, Inc.). The samples on grids were negatively stained with uranyl acetate (UA) ...
-
No products found
because this supplier's products are not listed.
Boris Bonaventure, et al.,
bioRxiv - Microbiology 2021
Quote:
... or J2 anti-dsRNA antibody (SCICONS), or anti-SARS-CoV-2 Nucleoprotein (N ...
-
No products found
because this supplier's products are not listed.
Emily M. Sontag, et al.,
bioRxiv - Biochemistry 2022
Quote:
... Anti-Nsp1 antibody from EnCor Biotechnology was used to visualize nuclear pores and Anti-Nsr1 antibody from Abcam was used for staining the nucleolus.
-
No products found
because this supplier's products are not listed.
Antigoni Gogolou, et al.,
bioRxiv - Developmental Biology 2021
Quote:
... and Rho-Associated Coil Kinase (ROCK) inhibitor Y-27632 2HCl (10 μM, Adooq Biosciences) with the latter being withdrawn from the differentiation medium after the first day of NMP induction ...
-
No products found
because this supplier's products are not listed.
Pei Xin Lim, Mahdia Zaman, Maria Jasin,
bioRxiv - Molecular Biology 2023
Quote:
... cell pellets were resuspended in wash buffer containing CD71− FITC antibody (Meridian Life Science) and RNaseA (Thermo Fisher) ...
-
No products found
because this supplier's products are not listed.
Shotaro Namba, Hisao Moriya,
bioRxiv - Cell Biology 2024
Quote:
... The membrane was then incubated with PBST containing peroxidase-conjugated secondary antibody (Nichirei bioscience) for 1 ...
-
No products found
because this supplier's products are not listed.
Jacqueline F. Rivera, et al.,
bioRxiv - Neuroscience 2023
Quote:
The amino terminal domain of GluA1 (1-394 a.a.) fused to a biotin acceptor tag (AviTag, Avidity) grown in suspension cultures of Sf9 cells was used as a target for the mRNA display selection ...
-
No products found
because this supplier's products are not listed.
Jay N. Joshi, et al.,
bioRxiv - Genetics 2024
Quote:
... Constructs of Spc105R with deletions or mutations of these domains were injected into Drosophila melanogaster embryos (Model System Genomics or BestGene). The linkage of the transgenes was determined and insertions on the 3rd chromosome were recombined onto the same chromosome as the shRNA GL00392.
-
No products found
because this supplier's products are not listed.
Susannah S. Adel, et al.,
bioRxiv - Neuroscience 2022
Quote:
... a solution containing AAV9.hsyn viruses encoding either full-length or the extracellular domain of either Sema4D or CD4 (designed and purified by Vector Biolabs) in combination with the same amount of AAV9.hsyn.GFP virus (Addgene ...
-
No products found
because this supplier's products are not listed.
Zhaoqian Wang, et al.,
bioRxiv - Biochemistry 2023
Quote:
... domain of LayV F (LayV HR2, KIDIGNQLAGINQTLQNAEDYIEKSEEFLKGINPSI) and the corresponding scrambled peptide (scrambled LayV HR2, SIANIQEKDIIKLETEDPEIYAGNKLGSQILNFGQN) were synthesized by Biosynth (Gardner, MA, USA).
-
No products found
because this supplier's products are not listed.
Yan Li, et al.,
bioRxiv - Neuroscience 2023
Quote:
... The sections were then incubated in serum blocking solution (5% donkey serum albumin in 0.1% Triton PBS) containing the primary polyclonal rabbit anti-PACAP antibody (1: 500 dilution, Peninsula Laboratories) or anti-PAC1 receptor (1:50 dilution ...
-
No products found
because this supplier's products are not listed.
Elizabeth J Glover, et al.,
bioRxiv - Neuroscience 2021
Quote:
... Permeabilization was enhanced by incubation in 0.4% Triton-X in PBS followed by incubation in primary antibodies in PBS containing 0.2% Triton-X overnight at 4 °C (CtB 1°: 1:500, List Biological Laboratories #703 ...
-
No products found
because this supplier's products are not listed.
Christopher W. Thomas, et al.,
bioRxiv - Neuroscience 2019
Quote:
... containing a running wheel (Campden Instruments), which were placed within ventilated sound-attenuated Faraday chambers (Campden Instruments) ...
-
Anti-Nucleocapsid Antibody (N-18) is an antibody targeting the nucleocapsid protein of...
Cat# A3132, SKU# A3132-1mg*5,
1mg*5, $1690.00
Ask
Vivek K. Bajpai, et al.,
bioRxiv - Cell Biology 2021
Quote:
... containing 10 μM SB431542 (Selleck Chemicals) and 500nM LDN193189 (Selleck Chemicals ...
-
No products found
because this supplier's products are not listed.
Dasmanthie De Silva, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... containing Stellaris RNA FISH probes (Biosearch Technologies) at a final concentration of 125 nM (Supplementary File 6 ...
-
No products found
because this supplier's products are not listed.
Sebastian N.W. Hoernstein, et al.,
bioRxiv - Plant Biology 2022
Quote:
... 10% DMSO containing 1mM AcLeu- pNA (Bachem) and incubated at 37°C for 30-120 min ...
-
No products found
because this supplier's products are not listed.
Logan R. Hurst, et al.,
bioRxiv - Cell Biology 2020
Quote:
... fusion reactions (60 μL) containing 20 μg of purified vacuoles were incubated in fusion reaction buffer containing 150 nM of Cal-520 (AAT Bioquest). Anti-Sec17 IgG was added at a concentration of 80 μg/mL to inhibit calcium efflux ...
-
No products found
because this supplier's products are not listed.
Vikas Arige, et al.,
bioRxiv - Physiology 2022
Quote:
... The IP3R1 antibody (#ARC154, Antibody Research Corporation) was used at 1:1000 dilution ...
-
No products found
because this supplier's products are not listed.
Concha Nieto, et al.,
bioRxiv - Immunology 2019
Quote:
... and containing M-CSF (10 ng/ml) (ImmunoTools GmbH) to generate M-MØ monocyte-derived macrophages ...
-
No products found
because this supplier's products are not listed.
Andrea P. Cabrera, et al.,
bioRxiv - Pathology 2021
Quote:
... containing protease and phosphatase inhibitors (Boston BioProducts, Ashland, MA), followed by centrifugation and loading of the equal amounts of protein into a 10% SDS-polyacrylamide gel ...
-
No products found
because this supplier's products are not listed.
Hong-Gyun Lee, et al.,
bioRxiv - Immunology 2024
Quote:
... containing 20 mM Tris-HCl (pH 7.5) (Teknova, #T5075), 1000 mM LiCl (Sigma-Aldrich ...
-
No products found
because this supplier's products are not listed.
Fei Li, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... and 0.5% blocking solution (Roche)] containing 100nM telomeric PNA probe TelC-FITC (F1009, PNA Bio), and hybridization was continued for 2 h at room temperature in the dark moisturized chambers ...
-
No products found
because this supplier's products are not listed.
Ruth Karlina, et al.,
bioRxiv - Cell Biology 2020
Quote:
... cells were selected with growth medium containing 2.5 μg/mL puromycin (Biomol). Cells were maintained and cultured in growth medium with puromycin ...
-
No products found
because this supplier's products are not listed.
Robert J. Cassell, et al.,
bioRxiv - Pharmacology and Toxicology 2019
Quote:
Sprague Dawley rat plasma containing K2-ethylenediaminetetraacetic acid (Innovative Research, MI, USA) was transferred into 300 μL aliquots and stored at −20 °C until use ...
-
No products found
because this supplier's products are not listed.
Michael G. Spelios, et al.,
bioRxiv - Immunology 2021
Quote:
... His-tagged peptide containing the SARS-CoV-2-specific furin motif (EpiGentek), and His-tagged SARS-CoV-2 S1 RBD protein lacking the S1/S2 boundary furin site (EpiGentek ...
-
No products found
because this supplier's products are not listed.
Nam Woo Cho, et al.,
bioRxiv - Immunology 2022
Quote:
... minced tumour was lysed using RIPA buffer containing protease inhibitor (Cell Biolabs) on ice for 10 minutes ...
-
No products found
because this supplier's products are not listed.
Jeffrey Marlow, et al.,
bioRxiv - Microbiology 2020
Quote:
... the sediment water was replaced with fluid containing HPG (Click Chemistry Tools, Scottsdale, AZ) for anabolic uptake ...
-
No products found
because this supplier's products are not listed.
Gergely Rona, et al.,
bioRxiv - Cell Biology 2024
Quote:
... Slides were then incubated overnight in prechilled comet lysis buffer (containing 10% DMSO) (Trevigen) at 4℃ ...
-
No products found
because this supplier's products are not listed.
Oiti Kar, et al.,
bioRxiv - Microbiology 2023
Quote:
... Monoclonal antibodies against Stx2A (Hycult Biotech) and homemade OmpA antiserum36 were used to detect Stx2A and OmpA ...
-
No products found
because this supplier's products are not listed.
MU Wagenhäuser, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... specific antibodies were used (Emfret Analytics, GPIb/CD42b ...
-
No products found
because this supplier's products are not listed.
Patrick Finneran, et al.,
bioRxiv - Biochemistry 2020
Quote:
... Cell Signaling Technology) as the primary antibody (1:2000 dilution) and ScanLater anti-rabbit antibody (Molecular Devices) as the secondary antibody (1:5000 dilution) ...
-
No products found
because this supplier's products are not listed.
Maria Czarnek, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... and incubated in ABB containing Annexin V conjugated with APC (1% v/v; Exbio, Vestec, Czechia) and PI (100 μg/ml ...
-
No products found
because this supplier's products are not listed.
Juan Pablo Arroyo, et al.,
bioRxiv - Physiology 2022
Quote:
Antibody was developed with assistance from Phosphosolutions Inc ...
-
No products found
because this supplier's products are not listed.
Shijie Cao, et al.,
bioRxiv - Bioengineering 2023
Quote:
... and plasma was analyzed for anti-OVA total IgG antibodies using a mouse anti-OVA IgG antibody assay kit (Chondrex). On day 13 ...