-
Recombinant Human BMP2 protein was expressed in Escherichia coli.
Cat# BMP2-01H,
50ug , USD $298
Ask
Yan Qi, et al.,
bioRxiv - Molecular Biology 2024
Quote:
... the presence of anti- Ad and anti-hemagglutinin antibodies was measured by ELISA against a purified Ad6 virus preparation (Greffex, Inc.) and a recombinant hemagglutinin protein (Creative Biomart). In the first case ...
-
No products found
because this supplier's products are not listed.
Petra Štěrbová, et al.,
bioRxiv - Biochemistry 2024
Quote:
... Cryo-EM images of the VLPs at pH 6.5 were recorded using a K2 camera (Gatan Inc., Pleasanton, CA, USA) in counting mode ...
-
No products found
because this supplier's products are not listed.
Yan Ni, et al.,
bioRxiv - Bioengineering 2020
Quote:
Cardiac Troponin I (8T53) and C-reactive protein (8C72) were purchased from Hytest. Anti-cetuximab (HCA221) ...
-
No products found
because this supplier's products are not listed.
Shu Liu, et al.,
bioRxiv - Neuroscience 2022
Quote:
... goat anti- xenotropic MLV virus antibody ABIN457298 (1:1000, antibodies-online); mouse anti- MLV gag ab100970 (1:1000 ...
-
No products found
because this supplier's products are not listed.
Angela Ma, et al.,
bioRxiv - Microbiology 2022
Quote:
... adenovirus (D3Ultra Respiratory Virus Screening & Identification kit, Quidel, San Diego, CA), and cytomegalovirus (D3 DFA Cytomegalovirus Immediate Early Antigen Identification kit ...
-
No products found
Yuanyuan He, et al.,
bioRxiv - Microbiology 2023
Quote:
Imaging plates for virus quantification were prepared by coating coverslip-bottom wells (Cellvis) with 0.18 mg/ml BSA-biotin in PBS overnight at 4 °C ...
-
No products found
because this supplier's products are not listed.
Wu Liu, et al.,
bioRxiv - Microbiology 2019
Quote:
... 2’-C-methyladenosine (2’-C-Me-A) was obtained from Carbosynth Limited (Compton ...
-
No products found
because this supplier's products are not listed.
Jessica Moretti, et al.,
bioRxiv - Neuroscience 2022
Quote:
... rabbit anti-c-Fos (1:2000, EnCor Biotechnology Inc., RPCA-c-Fos), 3% normal goat serum ...
-
No products found
because this supplier's products are not listed.
Kevin J. Kramer, et al.,
bioRxiv - Immunology 2021
Quote:
... values at the endpoint (48 h after incubation with the virus) were determined using the RTCA software version 2.1.0 (ACEA Biosciences Inc.). Results are expressed as percent neutralization in a presence of respective antibody relative to control wells with no CPE minus CI values from control wells with maximum CPE ...
-
No products found
because this supplier's products are not listed.
Janhavi Prasad Natekar, et al.,
bioRxiv - Microbiology 2022
Quote:
Tissues harvested from virus-inoculated animals were weighed and homogenized in a bullet blender (Next Advance, Averill Park, NY, USA) using stainless steel or zirconium beads ...
-
No products found
because this supplier's products are not listed.
Daria A. Egorova, et al.,
bioRxiv - Microbiology 2022
Quote:
... Total protein quantity was measured with QuDye Protein kit (Lumiprobe) on Qubit fluorometer (ThermoScientific).
-
No products found
because this supplier's products are not listed.
Samuel R. Witus, et al.,
bioRxiv - Biochemistry 2023
Quote:
... cells were shifted from 37 °C to 16 °C and supplemented with 1 mM Bpa (dissolved in 1M NaOH; Bachem) and 100 µM ZnCl2 ...
-
No products found
because this supplier's products are not listed.
Thanh Ngoc Nguyen, et al.,
bioRxiv - Cell Biology 2023
Quote:
... equipped with a 45 °C diamond knife (Diatome) was used to section the resin embedded samples ...
-
No products found
because this supplier's products are not listed.
Celia Fernandez-Sanz, et al.,
bioRxiv - Physiology 2021
Quote:
Equal amounts of protein (70 μg) supplemented with 5x Protein Loading Buffer (National Diagnostics, USA) were preheated (95°C ...
-
No products found
because this supplier's products are not listed.
Katarzyna Bogucka-Janczi, et al.,
bioRxiv - Cell Biology 2022
Quote:
... or ERK3 protein (M31-34G, SignalChem). ARP2/3 protein complex ...
-
No products found
because this supplier's products are not listed.
Yilun Sun, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... AcquaStain protein gel Coomassie stain (Bulldog Bio); Silver Stain solutions (Bio-Rad).
-
No products found
because this supplier's products are not listed.
Oksana Y. Dudaryeva, et al.,
bioRxiv - Bioengineering 2021
Quote:
... by dialysis at 4 °C (1000 g mol-1 MWCO; Spectrum Laboratories), 4 times 6 h ...
-
No products found
because this supplier's products are not listed.
Jun Xu, et al.,
bioRxiv - Zoology 2023
Quote:
... at 37°C for 30 min using glucose assay reagent (Megazyme; K-GLUC). We subtracted the amount of free glucose from the measurement and then normalized the subtracted values to protein levels in the supernatant ...
-
No products found
because this supplier's products are not listed.
Joydeb Sinha, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Harvested virus was 0.4μM filtered (Celltreat 229749) and concentrated by centrifugation using a 100kdA cut-off PES protein concentrator (Pierce 88533 ...
-
No products found
because this supplier's products are not listed.
Bettina C. Schwab, et al.,
bioRxiv - Neuroscience 2020
Quote:
We also performed microstimulation mapping of VLa and VLp (biphasic pulses <200μA, 0.2ms- duration at 300Hz; Model 2100, A-M Systems). Consistent with previous reports ...
-
No products found
because this supplier's products are not listed.
Axelle Brulport, et al.,
bioRxiv - Evolutionary Biology 2024
Quote:
... which were stimulated with E2 and P4 over a similar timecourse (Fitzgerald et al. 2019; Garcia-Alonso et al. 2021). The first dataset was sequenced as bulk transcriptomes using Illumina paired-end reads ...
-
C-Reactive Protein ( CRP ) ELISA / Assay Kit
Cat# K069-H5,
1.0 ea, USD $1520.0
Ask
Azure D. Grant, et al.,
bioRxiv - Physiology 2021
Quote:
A commercially available fE2 enzyme-linked immunosorbent assay (ELISA) kit was used to quantify E2 in fecal samples (Arbor Assays, Ann Arbor, MI). These assays have been previously published in species ranging from rats and mice(130–132) ...
-
No products found
because this supplier's products are not listed.
Youssouf Sereme, et al.,
bioRxiv - Microbiology 2020
Quote:
... A poliovirus serology-positive control serum (Poliomyelitis virus kit, GenWay, San Diego, California, USA) was also used as a control ...
-
No products found
because this supplier's products are not listed.
K. Kovalev, et al.,
bioRxiv - Biophysics 2019
Quote:
... The solubilized protein in the crystallization buffer was mixed with pre-melted at 42°C monoolein (Nu-Chek Prep) to form a lipidic mesophase ...
-
No products found
because this supplier's products are not listed.
Meropi Aravantinou, et al.,
bioRxiv - Immunology 2020
Quote:
... Virus titer was determined in CEMx174 cells (ATCC, Manassass, VA) by p27 ELISA quantification (ZeptoMetrix, Buffalo, NY) and syncytia scoring after 14 days with the calculation method of Reed and Meunch ...
-
No products found
because this supplier's products are not listed.
Yanhua Du, et al.,
bioRxiv - Epidemiology 2019
Quote:
The genomes of SFTS virus isolates were compiled using the SeqMan program in the LaserGene software package (DNAStar). The percentage similarities of nucleotide identity or amino acid identity were calculated using the ClustalX software[16] ...
-
No products found
because this supplier's products are not listed.
Joshua D. Powell, et al.,
bioRxiv - Microbiology 2024
Quote:
... NJ) and were seronegative to IAV antibodies by a commercial ELISA kit (Swine Influenza Virus Ab Test, IDEXX) prior to the start of the study ...
-
No products found
because this supplier's products are not listed.
Barbara Ciralli, et al.,
bioRxiv - Neuroscience 2023
Quote:
... cannabinol (Cerilliant C-046) and CBD (Cerilliant C-045 ...
-
No products found
because this supplier's products are not listed.
Yongsung Kim, et al.,
bioRxiv - Genomics 2024
Quote:
42 °C Incubator (Boekel Scientific™ model no ...
-
No products found
because this supplier's products are not listed.
M. Julhasur Rahman, et al.,
bioRxiv - Microbiology 2021
Quote:
The mCherry-E3L integration sites in the purified HGT virus genomes were located by inverse PCR amplification and by PacBio sequencing ...
-
No products found
because this supplier's products are not listed.
Qian Zhou, et al.,
bioRxiv - Neuroscience 2021
Quote:
We delivered ∼150 nl of AAV virus with a stereotaxic instrument (David Kopf Instruments, #PF-3983; RWD Life Science, #68030) and a pressure micro-injector (Nanoject II ...
-
No products found
because this supplier's products are not listed.
Avital Licht-Murava, et al.,
bioRxiv - Neuroscience 2022
Quote:
... per ml culture medium at DIV 8 using Lipofectamine 3000 5 h before infection with vesicular stomatitis virus (VSV) at 100 MOI or with adenovirus-eGFP (Ad5CMV-eGFP, lot #ad3586, Viral Vector Core Facility, Carver College of Medicine ...
-
No products found
because this supplier's products are not listed.
Arun Upadhyay, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Arg-C (Biovendor, Cat#RBG40003005), trypsin (Promega ...
-
No products found
because this supplier's products are not listed.
Melissa H. Bergeman, et al.,
bioRxiv - Microbiology 2023
Quote:
... Image segmentation and 3D rendering of HSV-1 virus particle undergoing exocytosis from Rab6a vesicle was done in Imaris (Oxford Instruments) by constructing spots and surfaces for the objects at respective image slices ...
-
No products found
because this supplier's products are not listed.
Yoko Miura, et al.,
bioRxiv - Pathology 2021
Quote:
... rabbit anti-SP-C (Hycult Biotech), rat anti-Podoplanin (MBL) ...
-
No products found
because this supplier's products are not listed.
Bo Fan, et al.,
bioRxiv - Bioengineering 2020
Quote:
... post-baked (65 °C and 95 °C for 1 min and 4 min, respectively) and developed in SU-8 developer (MicroChem). The SU-8 was hard-baked at 180 °C for 1 hour after development ...
-
No products found
because this supplier's products are not listed.
Laura Cheradame, et al.,
bioRxiv - Cancer Biology 2020
Quote:
Cell lysate protein concentration was determined using a Micro BCA Protein Assay kit (Bio Basic). Unless specified ...
-
No products found
because this supplier's products are not listed.
Iosifina P. Foskolou, et al.,
bioRxiv - Immunology 2022
Quote:
... Eu-Protein A (5 nM, Cisbio), Streptavidin-Alexa Fluor 647 (6.25 nM ...
-
No products found
because this supplier's products are not listed.
Molly M. Wilson, et al.,
bioRxiv - Cell Biology 2020
Quote:
... The pull-down of ubiquitinated proteins from protein extracts was performed with TUBE 2 agarose beads (LifeSensors), following the manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Katherine C. Woronowicz, et al.,
bioRxiv - Evolutionary Biology 2023
Quote:
... 8°C) and Covaris microTUBE Snap-Cap tubes (Covaris 520045). Sequencing libraries were produced using the KAPA HyperPrep Kit (Roche 07137923001 ...
-
No products found
because this supplier's products are not listed.
Zhijun Chen,
bioRxiv - Cancer Biology 2023
Quote:
... CYCS/Cytochrome c ELISA Kit (LS-F11267) from LifeSpan BioSciences was used to determine the apoptosis of cells following the instructions of the kit ...
-
No products found
because this supplier's products are not listed.
Tsai-Ning Li, et al.,
bioRxiv - Neuroscience 2020
Quote:
... 5 μM BODIPY-TMR Phosphatidylinositol 4,5-bisphosphate (C-45M16A, Echelon Bioscience), furimazine (Promega ...
-
No products found
because this supplier's products are not listed.
Priyanka Chatterjee, et al.,
bioRxiv - Microbiology 2024
Quote:
... Escherichia coli strains were grown at 37°C in NZCYM (RPI) medium supplemented with ampicillin (100 µg mL-1 final ...
-
No products found
because this supplier's products are not listed.
Mingyu Fang, et al.,
bioRxiv - Biochemistry 2021
Quote:
... gels were either stained with Coomassie (Protein Ark) or transferred to PVDF membranes for Western blot analysis.
-
No products found
because this supplier's products are not listed.
Patrik Risteski, et al.,
bioRxiv - Cell Biology 2024
Quote:
... and human anti-centromere protein antibody (Antibodies Incorporated). The secondary antibodies used were donkey anti-mouse IgG-Alexa Fluor 488 (Abcam) ...
-
No products found
because this supplier's products are not listed.
Julia Fath, et al.,
bioRxiv - Cell Biology 2022
Quote:
... with 1 μM TAMRA-sheperdin-C-ter BDNF (TAMRA-KHSSGCAFLKKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France), or with TAMRA fluorophore alone for 20 minutes ...
-
No products found
because this supplier's products are not listed.
M. Martinez, et al.,
bioRxiv - Microbiology 2023
Quote:
... at 4°C and loaded 3 times in a CellD disrupter (Constant Systems). The lysate was centrifuged for 15min at 12000 x g at 4°C to remove cell debris and the supernatant was centrifuged again for 1h at 100000 x g at 4°C ...
-
No products found
because this supplier's products are not listed.
Amanda N. Scholes, Jeffrey A. Lewis,
bioRxiv - Genomics 2019
Quote:
... and then placed in a 65°C preheated Multi-Therm incubated vortexer (Benchmark Scientific) at 1500 rpm for 45 minutes ...
-
No products found
because this supplier's products are not listed.
Mathieu Métivier, et al.,
bioRxiv - Cell Biology 2020
Quote:
... dialyzed overnight in PBS at 4°C and used for guinea pig immunization (Covalab).
-
No products found
because this supplier's products are not listed.
Kit-Yi Leung, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... GLDC protein abundance was determined using anti-GLDC antibody (Atlas antibodies), with GAPDH (detected using anti-GAPDH ...