-
No products found
because this supplier's products are not listed.
Daniel D. Lane, et al.,
bioRxiv - Bioengineering 2024
Quote:
... thrombopoetin (TPO) and Flt-3 ligand (both from CellGenix, Freiburg, Germany). An overnight pre-treatment incubation was carried out after thaw at 37 °C ...
-
No products found
because this supplier's products are not listed.
Tian Yu, et al.,
bioRxiv - Neuroscience 2020
Quote:
We utilized Mouse c-Fos antibody (1:1000, PhosphoSolutions; Cat# ...
-
No products found
because this supplier's products are not listed.
Matthew Pierpoint, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... Chromosomes were incubated in Tel C Cy 3 PNA probe (PNA Bio) at 83 °C for 5 minutes and allowed to hybridize at room temperature in a dark hybridization chamber for 2 hours at room temperature ...
-
No products found
because this supplier's products are not listed.
M. Martinez, et al.,
bioRxiv - Microbiology 2023
Quote:
... at 4°C and loaded 3 times in a CellD disrupter (Constant Systems). The lysate was centrifuged for 15min at 12000 x g at 4°C to remove cell debris and the supernatant was centrifuged again for 1h at 100000 x g at 4°C ...
-
No products found
because this supplier's products are not listed.
Ignasi Casanellas, et al.,
bioRxiv - Bioengineering 2021
Quote:
... immunostained with anti-C×43 antibody and Sir-Actin (Tebu-bio, SC001), and imaged with a Zeiss LSM780 Confocal Microscope (Zeiss Microscopy ...
-
No products found
because this supplier's products are not listed.
Yongsung Kim, et al.,
bioRxiv - Genomics 2024
Quote:
42 °C Incubator (Boekel Scientific™ model no ...
-
Cystatin-C ELISA / assay Kit
Cat# K012-H1,
1.0 ea, USD $385.0
Ask
Lisa Mohr, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... 4°C for 10 min and 2′3′-cGAMP levels were quantified using the 2′3′-cGAMP ELISA Kit (Arbor Assays) according to the manufacturer’s instructions.
-
No products found
because this supplier's products are not listed.
Yan Ni, et al.,
bioRxiv - Bioengineering 2020
Quote:
... and C-reactive protein antibodies C6 (4C28cc) and C135 (4C28) were obtained from Hytest. Therapeutic antibodies cetuximab and infliximab were obtained via the Catherina hospital pharmacy in Eindhoven and Maxima Medisch Centrum pharmacy in Veldhoven ...
-
No products found
because this supplier's products are not listed.
Tristan Frum, Jennifer Watts, Amy Ralston,
bioRxiv - Developmental Biology 2019
Quote:
... Primary antibody incubation was performed at 4°C overnight using the following antibodies: goat anti-SOX2 (Neuromics, GT15098, 1:2000), rabbit anti-NANOG (Reprocell ...
-
No products found
because this supplier's products are not listed.
Nadezda A. Fursova, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... Antibody-bound nucleosomes were captured for 1 hr at 4°C using protein A agarose (Repligen) beads ...
-
No products found
because this supplier's products are not listed.
Benjamin J. Reisman, et al.,
bioRxiv - Biochemistry 2021
Quote:
... 1.6 mM BTTAA ligand (Click Chemistry Tools), and 5 mM sodium ascorbate ...
-
No products found
because this supplier's products are not listed.
Natalia Gebara, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... and 2% Chang Medium C (Irvine Scientific), 20% Fetal Calf Serum (Invitrogen ...
-
No products found
because this supplier's products are not listed.
Dennis J Doorduijn, et al.,
bioRxiv - Immunology 2019
Quote:
... Nunc Maxisorp ELISA plates were coated overnight at 4 °C with 50 µl/well of 3 µg/ml monoclonal mouse IgG1 anti human C6 (Quidel) in PBS ...
-
No products found
because this supplier's products are not listed.
Marta F. M. Vieira, et al.,
bioRxiv - Biophysics 2021
Quote:
All constructs (C-Tir, C-SH2, N-Tir, and NS-Tir) were sub-cloned into the pHTP8 plasmid (NZYTech), bearing a cleavable His6-tagged thioredoxin tag (TRX-His6 ...
-
No products found
because this supplier's products are not listed.
Chuanhai Zhang, et al.,
bioRxiv - Cell Biology 2024
Quote:
... Cells were than incubated with the CLSTN3B antibody at 4°C overnight and then with the fluoronanogold secondary antibody (Nanoprobes 7403-1) for 2 h at RT ...
-
No products found
because this supplier's products are not listed.
Bo Fan, et al.,
bioRxiv - Bioengineering 2020
Quote:
... post-baked (65 °C and 95 °C for 1 min and 4 min, respectively) and developed in SU-8 developer (MicroChem). The SU-8 was hard-baked at 180 °C for 1 hour after development ...
-
No products found
Ashaq Hussain, Malay Kumar Ray,
bioRxiv - Microbiology 2022
Quote:
... syringae Lz4W was routinely grown at 22°C or 4°C (for optimum and low temperatures respectively) in Antarctic bacterial medium (ABM) composed of 5 g/l peptone and 2.0 g/l yeast extract ...
-
No products found
because this supplier's products are not listed.
Samuel R. Witus, et al.,
bioRxiv - Biochemistry 2023
Quote:
... cells were shifted from 37 °C to 16 °C and supplemented with 1 mM Bpa (dissolved in 1M NaOH; Bachem) and 100 µM ZnCl2 ...
-
No products found
because this supplier's products are not listed.
Andrew LaPoint, et al.,
bioRxiv - Physiology 2023
Quote:
... and cholesterol (2%) (HFHF-C, Research Diets, D09100310) diet or a matched sucrose ...
-
No products found
because this supplier's products are not listed.
Lisa-Marie Appel, et al.,
bioRxiv - Biochemistry 2022
Quote:
Crystalization was performed at at 22°C or 4°C using a sitting-drop vapour diffusion technique and micro-dispensing liquid handling robot Mosquito (TTP labtech). The best diffracting crystals of SHARP SPOC:1xS5P CTD were grown at 22°C in conditions E9 from ShotGun HT screen (SG1 HT96 Molecular Dimensions ...
-
No products found
because this supplier's products are not listed.
Ingrid Lekk, et al.,
bioRxiv - Developmental Biology 2019
Quote:
... was used for block and for over-night primary antibody incubation at 4°C with the following antibodies: rabbit anti-GFP (dilution 1:1000, Torrey Pines Biolabs, Cat# TP401), mouse anti-acetylated tubulin (dilution 1:250 ...
-
No products found
because this supplier's products are not listed.
Jessica L. Bolton, et al.,
bioRxiv - Neuroscience 2021
Quote:
... sustained-release CNO- or placebo-containing pellets (CNO: cat# X-999, 0.025 mg/pellet, 8-day release; Placebo: cat# C-111; Innovative Research of America, Sarasota, FL, USA) were inserted under the skin (s.c. ...
-
No products found
because this supplier's products are not listed.
Saejeong Park, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... fixed in warm 4% paraformaldehyde (Thomas Scientific, 37 °C) for 5 min and washed with PBS 3 times ...
-
No products found
because this supplier's products are not listed.
Lingling Zhang, et al.,
bioRxiv - Immunology 2023
Quote:
... feeder cells were treated with Mitomycin C (Apexbio Technology) at the concentration of 10 μg/mL for 2 hours and then washed with PBS ...
-
No products found
because this supplier's products are not listed.
Satish Rojekar, et al.,
bioRxiv - Bioengineering 2023
Quote:
... or at 37 °C in a water bath (PolyScience), and analyzed by dynamic light scattering or protein thermal shift assay ...
-
No products found
because this supplier's products are not listed.
Thibault Legal, et al.,
bioRxiv - Cell Biology 2020
Quote:
... Cheeseman, 1: 1000), guinea pig CENP-C (pAb, MBL PD030, 1:2000) and human ACA antibodies (Cambridge Biosciences, 1:100). Hoechst 33342 (ThermoFisher Scientific ...
-
No products found
because this supplier's products are not listed.
Jasmin Wächter, et al.,
bioRxiv - Developmental Biology 2022
Quote:
... and incubated with combinations of the indicated antibodies overnight at 4 °C: mouse monoclonal anti-HLA-G (clone 4H84; 1:100; Exbio); rabbit monoclonal anti-cytokeratin 7 (clone SP52 ...
-
No products found
because this supplier's products are not listed.
Hong Zheng, et al.,
bioRxiv - Microbiology 2021
Quote:
... the cells were labeled with 1:500 rabbit anti-CSP overnight at 4°C and 1:100 Red donkey anti-rabbit secondary antibody (Abbkine) for 1 h at room temperature ...
-
No products found
because this supplier's products are not listed.
Shiran Barber-Zucker, et al.,
bioRxiv - Biophysics 2020
Quote:
... Protein was then labelled overnight at 4 °C with (1-oxyl-2,2,5,5-tetramethylpyrrolidin-3- yl)methylthiosulfonate spin label (MTSL, 20x excess) (Toronto Research Chemicals Inc., North York, Ontario, Canada) with gentle agitation ...
-
No products found
because this supplier's products are not listed.
Lauren S. Levine, et al.,
bioRxiv - Immunology 2020
Quote:
... Lm-OVA stocks frozen at −80 C were grown overnight at 37°C in BHI broth supplemented with 5 ug/ml Erythromycin (Bio Basic, Amherst, New York). Then ...
-
No products found
because this supplier's products are not listed.
Anar Alshanbayeva, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... for 1 h at room temperature and incubated with primary antibodies overnight at 4 °C with anti-Cd9 ([1:3000; System Biosciences, Palo Alto ...
-
No products found
because this supplier's products are not listed.
Shinnosuke Honda, et al.,
bioRxiv - Developmental Biology 2023
Quote:
... and then incubated overnight at 4°C with a rabbit anti-NANOG antibody (1:100 dilution; RCAB002P-F; ReproCELL, Kanagawa, Japan) and a mouse anti-CDX2 antibody (1:100 dilution ...
-
No products found
because this supplier's products are not listed.
Andrew J. Lutkewitte, et al.,
bioRxiv - Physiology 2020
Quote:
... or AAV8-GFP-U6-Mogat1-shRNA (sequences 5-UUUCACCCUCAUGGAAUAUUCGUGCCU-3 and 5-CAAGACGCAAUGUAUGAUUCAAUGGGA-3 [20]; pooled (2.0 x 1011 GC total) before injection (Vector Biolabs). For hepatic Mogat1 overexpression ...
-
No products found
because this supplier's products are not listed.
Tsai-Ning Li, et al.,
bioRxiv - Neuroscience 2020
Quote:
... 5 μM BODIPY-TMR Phosphatidylinositol 4,5-bisphosphate (C-45M16A, Echelon Bioscience), furimazine (Promega ...
-
No products found
because this supplier's products are not listed.
Ronald McGregor, et al.,
bioRxiv - Neuroscience 2023
Quote:
... and incubated for 72 hours at 4°C in a PBST solution containing rabbit anti-Hcrt-1 primary antibody (1:10000, H-003-30, Lot # 01108, Phoenix Pharmaceuticals Inc.) or rabbit anti-MCH (1:20000 ...
-
No products found
because this supplier's products are not listed.
Jun Xu, et al.,
bioRxiv - Zoology 2023
Quote:
... at 37°C for 30 min using glucose assay reagent (Megazyme; K-GLUC). We subtracted the amount of free glucose from the measurement and then normalized the subtracted values to protein levels in the supernatant ...
-
No products found
because this supplier's products are not listed.
MegAnne Casey, et al.,
bioRxiv - Neuroscience 2023
Quote:
... using the primary antibodies rabbit anti-cleaved caspase-3 (Trevigen) and chicken anti-Atp7a (Sigma) ...
-
No products found
because this supplier's products are not listed.
Yosif Zaki, et al.,
bioRxiv - Neuroscience 2021
Quote:
... Layers of adhesive cement (C&B Metabond) followed by dental cement (A-M Systems) were spread over the surgical site ...
-
No products found
because this supplier's products are not listed.
Mathew Miller, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... and Buffer C is the buffer recommended by the CleanCap® AG manufacturer (Trilink) for use with WT T7RNAP ...
-
No products found
because this supplier's products are not listed.
Mastura Akter, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Stainless steel guide cannulae (Double/O.D.0.41mm-27G/C, cat # 62069, RWD life science.com.ltd.) were bilaterally positioned into ACC region (2.4 mm anterior to bregma and 0.5 mm lateral from midline ...
-
No products found
because this supplier's products are not listed.
Shan Jiang, et al.,
bioRxiv - Synthetic Biology 2023
Quote:
... The protein standard with the C-terminal FLAG tag (E-PKSH032870.10) was from Biomol. Linear DNA templates were produced by PCR and were PCR purified ...
-
No products found
because this supplier's products are not listed.
Kelly Snead, et al.,
bioRxiv - Biochemistry 2022
Quote:
... at 4°C using 40µL bed volume (BV) nickel-charged IMAC tips (Biotage, Uppsala, Sweden). The columns were washed in a 96-well deepwell plate with 20BV dH2O and then equilibrated in 20BV of 20mM HEPES pH 7.4 ...
-
No products found
because this supplier's products are not listed.
Martin Dlask, et al.,
bioRxiv - Biophysics 2019
Quote:
We used a measurement system based on cooled (−30 °C) low-noise photomultiplier tube (PMT) R2256-02 (all components of the system from Hamamatsu Photonics Deutschland ...
-
No products found
because this supplier's products are not listed.
Sami T. Tuomivaara, et al.,
bioRxiv - Biochemistry 2023
Quote:
... supplemented with 2% in-house heat-treated (56 °C for 30 min) FBS (Atlanta Biologicals) and GlutaMAX (for proteomics) ...
-
No products found
because this supplier's products are not listed.
Magdalena Miranda, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Temperature was controlled with a servo-controlled heating pad (37°C ± 0.5; Fine Science Tools, Vancouver, Canada). Craniotomies for tetrode implantation were drilled in the skull above the CA3 (AP ...
-
No products found
because this supplier's products are not listed.
Koen van de Ven, et al.,
bioRxiv - Microbiology 2021
Quote:
... plates were incubated for 60 minutes at 37°C with HRP-conjugated goat anti-ferret IgG (Alpha Diagnostic), diluted 1:5000 in PBS containing 0.1% Tween-80 and 0.5% Protivar (Nutricia) ...
-
No products found
because this supplier's products are not listed.
Ugo Dionne, et al.,
bioRxiv - Systems Biology 2020
Quote:
... the pre-column was switch online with a self-made 50 cm x 75 um internal diameter separation column packed with ReproSil-Pur C18-AQ 3-μm resin (Dr. Maisch HPLC) and the peptides were eluted with a linear gradient from 5-40% solvent B (A ...
-
8 Well Chambered Cover Glass with #1 cover glass (0.13-0.16mm), with lid, sterilized. Designed...
Cat# C8-1-N,
48/case, $219.00
Ask
Anil G Cashikar, et al.,
bioRxiv - Cell Biology 2022
Quote:
Mouse primary astrocytes were seeded at a density of 3 X 104 cells in a 8-well chamber slide (CellVis, C8-1.5P). Oleic acid was added as Oleic acid-bovine serum albumin (Sigma O-3008 ...
-
No products found
because this supplier's products are not listed.
Julia Fath, et al.,
bioRxiv - Cell Biology 2022
Quote:
... with 1 μM TAMRA-sheperdin-C-ter BDNF (TAMRA-KHSSGCAFLKKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France), or with TAMRA fluorophore alone for 20 minutes ...
-
No products found
because this supplier's products are not listed.
Chen Farhy, et al.,
bioRxiv - Cell Biology 2019
Quote:
... or 1Gy x-ray radiation (RS2000; RAD Source) was carried out for 4 days on single set (‘treatment set’) ...