-
No products found
because this supplier's products are not listed.
Dipanwita Sadhukhan, et al.,
bioRxiv - Neuroscience 2023
Quote:
... For the measurement of mature BDNF (mBDNF) and Pro-BDNF using mature and Pro-BDNF Rapid ELISA Kit (Biosensis, Thebarton, Australia), the platelet free supernatant was diluted in assay diluent in 1:20 dilution ratio followed by addition to the precoated microplate wells and incubation for 45 min (mBDNF ...
-
No products found
because this supplier's products are not listed.
Daniel Frankel, et al.,
bioRxiv - Biophysics 2020
Quote:
... human (Anaspec) was reconstituted with 1.0% NH4OH and aliquoted before freezing ...
-
No products found
because this supplier's products are not listed.
Michael J. Pereira, et al.,
bioRxiv - Microbiology 2021
Quote:
... Normal human serum (Complement Technologies) was diluted to 2.3% (v/v ...
-
No products found
because this supplier's products are not listed.
Redouane Aherrahrou, et al.,
bioRxiv - Genetics 2023
Quote:
... Human aortic SMCs (Cell Applications, Inc. ...
-
No products found
because this supplier's products are not listed.
M. Sandonà, et al.,
bioRxiv - Cell Biology 2020
Quote:
... anti human CD31-FITC (#21270313, Immunotools), anti human CD45-FITC (#130-080-202 ...
-
No products found
because this supplier's products are not listed.
Coralie Berthoux, et al.,
bioRxiv - Neuroscience 2021
Quote:
... Recombinant human BDNF protein was purchased from Hello Bio. Salts for making ACSF and internal solutions were purchased from Sigma-Aldrich.
-
No products found
because this supplier's products are not listed.
Jacob Kumro, et al.,
bioRxiv - Neuroscience 2022
Quote:
Primary antibodies used were anti-BDNF (1:1000, GTX134514, GeneTex ®, Irvine, CA), anti-NGF ...
-
No products found
because this supplier's products are not listed.
Bipan K. Deb, et al.,
bioRxiv - Neuroscience 2023
Quote:
... the developing hBOs were grown in neural induction media supplemented with 20 ng/ml BDNF (VWR: RL009-001-C27) and 20 ng/ml NT-3 (Sigma ...
-
No products found
because this supplier's products are not listed.
Trine Lisberg Toft-Bertelsen, et al.,
bioRxiv - Neuroscience 2022
Quote:
... or humans (MBS707296, MyBioSource). The CSF samples were added to wells pre-coated with LPA antibody ...
-
No products found
because this supplier's products are not listed.
Philipp Kolb, et al.,
bioRxiv - Microbiology 2020
Quote:
... human Fcγ-TexasRed (Rockland). Rituximab® (Rtx ...
-
No products found
because this supplier's products are not listed.
Ruri Tsuneishi, et al.,
bioRxiv - Cell Biology 2020
Quote:
... Human Albumin (CEDARLANE, CLFAG2140), Cytokeratin 7 (DAKO ...
-
No products found
because this supplier's products are not listed.
M. Fenu, et al.,
bioRxiv - Biophysics 2023
Quote:
... human fibrinogen (Enzyme Research Laboratories, plasma purified ...
-
No products found
because this supplier's products are not listed.
Ji Yeon Hong, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... and human Sprr1a (GeneCopoeia, HQP060361) were employed to detect expression of Sprr1a ...
-
No products found
because this supplier's products are not listed.
Daniel R. Hummel, et al.,
bioRxiv - Cell Biology 2023
Quote:
Human platelet actin (Cytoskeleton Inc.) was polymerized in F-actin buffer (5 mM Tris-HCl ...
-
No products found
because this supplier's products are not listed.
Rebecca Scarfò, et al.,
bioRxiv - Developmental Biology 2023
Quote:
The anti–human uncoupled primary antibodies used are listed: anti-human CD34 (Beckman, QBEnd/10), anti-human ACE (BB9 ...
-
No products found
because this supplier's products are not listed.
Erin A. Stephens, et al.,
bioRxiv - Synthetic Biology 2021
Quote:
... 50 μM human ubiquitin (Boston Biochem), 4 mM ATP and 1 mM DTT in 20 mM MOPs ...
-
No products found
because this supplier's products are not listed.
Damon A. Hofman, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... human EGF (20ng/mL; Shenandoah Biotech), human FGF-basic-154 (20ng/mL ...
-
No products found
because this supplier's products are not listed.
Zbigniew Korwek, et al.,
bioRxiv - Immunology 2023
Quote:
... Human interferon β (PBL Assay Science) was used at a typical concentration of 1000 U/ml and ...
-
No products found
because this supplier's products are not listed.
Ishier Raote, et al.,
bioRxiv - Cell Biology 2020
Quote:
... calreticulin (goat anti–human; Enzo Life Sciences), HA (mouse ...
-
No products found
because this supplier's products are not listed.
S. Jordan Kerns, et al.,
bioRxiv - Cancer Biology 2021
Quote:
Human alveolar epithelial cells (Cell Biologics, Accegen) were cultured using SABM medium (Lonza ...
-
No products found
Katharina M. Eyme, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... human recombinant EGF (20 ng/mL; ABM), and human recombinant bFGF-2 (10ng/mL ...
-
No products found
because this supplier's products are not listed.
Katerina Jerabkova, et al.,
bioRxiv - Cell Biology 2020
Quote:
... human polyclonal CREST (Antibodies Incorporated, 15 234), rabbit polyclonal Aurora B (Abcam ab2254) ...
-
No products found
because this supplier's products are not listed.
Zintis Inde, et al.,
bioRxiv - Cell Biology 2020
Quote:
Human tissue microarrays were obtained from US Biomax, Inc ...
-
CSC 2F0 cells were isolated by centrifugal counterflow elutriation from 250 individual donor...
Cat# CSC 2F0 V,
1.0 Units, $405.0
Ask
Changsheng Chen, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Human retinal microvascular endothelial cells (HRMECs, Cell System) were cultured in a complete classic medium supplemented with/without high-content glucose (50 or 100 mM) ...
-
No products found
because this supplier's products are not listed.
Bret Sanders, et al.,
bioRxiv - Genetics 2021
Quote:
... 10ng/ml BDNF (Cambridge Bioscience) and 200µM ascorbic acid (Sigma) ...
-
No products found
because this supplier's products are not listed.
Julia Fath, et al.,
bioRxiv - Cell Biology 2022
Quote:
... with 1 μM TAMRA-sheperdin-C-ter BDNF (TAMRA-KHSSGCAFLKKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France), or with TAMRA fluorophore alone for 20 minutes ...
-
No products found
because this supplier's products are not listed.
Yash Agarwal, et al.,
bioRxiv - Immunology 2020
Quote:
... Paraffin embedded fixed sections were stained via hematoxylin and eosin or with indicated human antibodies 24 (anti-human CD45-Biocare Medical Cat. No. CME PM016AA; anti-human CD3-Biocare Medical Cat ...
-
No products found
because this supplier's products are not listed.
Noah R. Johnson, et al.,
bioRxiv - Neuroscience 2021
Quote:
... recombinant human Aβ40 (rPeptide), recombinant human scrambled Aβ42 (rPeptide) ...
-
No products found
because this supplier's products are not listed.
Marina Boudigou, et al.,
bioRxiv - Immunology 2021
Quote:
... Pancoll human (PAN Biotech). CD19+ B cells were purified from human PBMCs using the REAlease® CD19 Microbead Kit (Miltenyi Biotec ...
-
No products found
because this supplier's products are not listed.
Lih-Yun Hsu, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... Human IL-2 concentration was measured with the AlphaLISA human IL2 Kit (PerkinElmer) and data collected on an Envision Plate Reader (PerkinElmer) ...
-
No products found
because this supplier's products are not listed.
Indira Wu, Hee Shin Kim, Tuval Ben-Yehezkel,
bioRxiv - Genomics 2019
Quote:
... while human liver total RNA and human blood total RNA were purchased from Zyagen. LoopSeq Transcriptome kit was obtained from Loop Genomics ...
-
No products found
because this supplier's products are not listed.
Joshua G. Pemberton, et al.,
bioRxiv - Cell Biology 2019
Quote:
... Angiotensin II (Human octapeptide; Bachem) was first dissolved in ethanol at 1mM before being prepared as 100 μM aliquots for storage by dilution with ddH2O water ...
-
No products found
because this supplier's products are not listed.
Damian Dudka, R. Brian Akins, Michael A. Lampson,
bioRxiv - Cell Biology 2023
Quote:
... Centromeres were labeled with CREST (human anti-human Anti-Centromere Antibody, 1:200, Immunovision, HCT-0100) and an Alexa Fluor 594–conjugated goat anti-human secondary antibody (ThermoFisher ...
-
No products found
because this supplier's products are not listed.
Bradley A. Ruple, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... ii) rabbit anti-human TFAM (Abnova; Taipei ...
-
No products found
because this supplier's products are not listed.
Aum R. Patel, et al.,
bioRxiv - Microbiology 2021
Quote:
Normal Adult Human Dermal Fibroblasts and Normal Human Skeletal Muscle Satellite Cells (SkMc) (Lifeline Cell Technologies, USA) were cultured using FibroLife S2 Medium and StemLife SK Medium ...
-
No products found
because this supplier's products are not listed.
Baishakhi Ghosh, et al.,
bioRxiv - Cell Biology 2021
Quote:
Primary non-diseased human bronchial epithelial (NHBE) and COPD human bronchial epithelial (CHBE) cells were purchased from MatTek Life Sciences (Ashland ...
-
No products found
because this supplier's products are not listed.
Matthew D. J. Dicks, et al.,
bioRxiv - Bioengineering 2022
Quote:
... Human coagulation Factor X (hFX) (Haematologic Technologies) was added to diluted vectors at a final concentration of 8 μg/mL ...
-
No products found
because this supplier's products are not listed.
Sonali Jindal, et al.,
bioRxiv - Cancer Biology 2020
Quote:
... human COX2 protein (Cayman Chemical, 60122, 4ng), and 25μg cell line lysates in RIPA buffer were separated by WES automated gel electrophoresis System (Protein Simple ...
-
No products found
because this supplier's products are not listed.
Christin Naumann, et al.,
bioRxiv - Plant Biology 2021
Quote:
... All reagents except human ceruloplasmin (Athens Research) were purchased from Sigma-Aldrich ...
-
No products found
because this supplier's products are not listed.
Joelle P. Straehla, et al.,
bioRxiv - Bioengineering 2021
Quote:
Human iPS-ECs (Fujifilm Cellular Dynamics, 11713), human brain PCs and ACs (ScienCell) ...
-
No products found
because this supplier's products are not listed.
Babek Alibayov, et al.,
bioRxiv - Microbiology 2022
Quote:
... Human serum was purchased from MP Biomedicals.
-
No products found
because this supplier's products are not listed.
Ricardo da Silva Antunes, et al.,
bioRxiv - Immunology 2023
Quote:
... in 5% human serum (Gemini Bio-Products) for 24 h ...
-
No products found
because this supplier's products are not listed.
Jianfang Li, et al.,
bioRxiv - Developmental Biology 2021
Quote:
... Human C-peptide levels in isolated plasma were quantified using the STELLUX Chemi Human C-peptide ELISA kit (ALPCO Diagnostics) according to the manufacturer’s instructions.
-
No products found
because this supplier's products are not listed.
Ling Ning Lam, et al.,
bioRxiv - Microbiology 2021
Quote:
... and inoculated at a ratio of 1:1000 into pooled human serum or pooled human urine (both purchased from Lee Biosolutions). At selected time points ...
-
No products found
because this supplier's products are not listed.
Deborah. L. W. Chong, et al.,
bioRxiv - Cell Biology 2020
Quote:
... or human CD61 (clone 2f2, Leica Biosystems, Wetzlar, Germany). Sections were scanned on a Nanozoomer Digital Slide Scanner and analysed using NDP.view software (both from Hamamatsu Corporation ...
-
No products found
because this supplier's products are not listed.
Jessica Ciesla, Isreal Moreno Jr., Joshua Munger,
bioRxiv - Microbiology 2022
Quote:
TNFα (Human) was purchased from GoldBio (#1130-01-100) and suspended in sterilized water to 1 mg/mL concentration ...
-
No products found
because this supplier's products are not listed.
Katharina Hoette, et al.,
bioRxiv - Cell Biology 2019
Quote:
... Isolation of organoids from the embedding matrix (human hepatic organoids: Matrigel, Corning; human pancreatic organoids: Cultrex BME2, Amsbio) for fixation and whole-mount staining was performed with slight modifications of protocols published by Broutier et al ...
-
No products found
because this supplier's products are not listed.
Marco Di Gioia, et al.,
bioRxiv - Immunology 2023
Quote:
... recombinant human AKT1 (BPS Bioscience, Cat# 40003), AKT2 (BPS Bioscience ...
-
No products found
because this supplier's products are not listed.
Wei-Li Ling, Samuel Ken-En Gan,
bioRxiv - Immunology 2022
Quote:
KD measurements of Fc-tagged Human FcμR (Cat: 13556-H02H, SinoBiological) immobilised on Anti-Human IgG Fc (AHC) (Cat: 18-5060, Sartorius) biosensors were performed on the Octet Red96® system with the loading threshold set at 1.0 nm and utilizing the recombinant Pertuzumab and Trastuzumab IgM VH whole antibodies variants in five serial diluted concentrations (12.5 to 200nM ...
-
No products found
because this supplier's products are not listed.
Chang-Hoon Kim, et al.,
bioRxiv - Molecular Biology 2021
Quote:
Recombinant Flag-tagged human G9a (Active Motif, 31410), human calpain 1 (Novus ...