-
No products found
because this supplier's products are not listed.
Razieh Rafieenia, et al.,
bioRxiv - Microbiology 2022
Quote:
... Glyphosate concentrations were measured using a glyphosate ELISA kit (Abraxis, Eurofin Technologies, Hungary).
-
No products found
because this supplier's products are not listed.
Carina C D Joe, et al.,
bioRxiv - Bioengineering 2021
Quote:
Residual host-cell protein (HCP) was quantified using the HEK293 HCP ELISA kit (Cygnus Technologies) according to the manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
K Seto, TY James,
bioRxiv - Evolutionary Biology 2023
Quote:
... were inoculated onto 20 plates of WC medium (1% agar) and each plate was sealed with Parafilm M laboratory film (Bemis). After 3 days of incubation at 20 °C and under LED lighting ...
-
No products found
because this supplier's products are not listed.
Karl Kochanowski, et al.,
bioRxiv - Cancer Biology 2020
Quote:
... Plates were sealed with BreathEasy foil (Neta Scientific, CAT RPI-248738) to minimize evaporation and incubated at 37C with 5% CO2 for 16-20h before starting the time lapse microscopy experiments to allow cells to adhere to the plate bottom.
-
No products found
because this supplier's products are not listed.
Karen Mruk, et al.,
bioRxiv - Developmental Biology 2019
Quote:
... a plate containing E3 medium and embryos was mounted onto a mirrored surface and then fixed onto a Vortex-Genie (Scientific Industries). Dechorionated embryos were irradiated using a blue LED light source (TaoTronics) ...
-
No products found
because this supplier's products are not listed.
Carla Merino, et al.,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
4-(Methylnitrosamino)-1-(3-pyridyl)-1-butanone (NNK) was obtained from LGC-Dr Ehrenstorfer (LGC Standards, Barcelona, Spain) and 4-Hydroxy-4-(3-pyridyl)-butyric acid (HPBA ...
-
No products found
because this supplier's products are not listed.
Lisa Pomeranz, et al.,
bioRxiv - Bioengineering 2023
Quote:
ELISA plates were coated with 1µg/mL human spleen ferritin (Lee Biosolutions, MO) in PBS overnight at 4°C ...
-
No products found
because this supplier's products are not listed.
Isabelle Fabrizi, et al.,
bioRxiv - Paleontology 2023
Quote:
... Tryptic peptides were desalted on 96-well plates C18 (Affinisep, Petit-Couronne, France) following the protocol described below.
-
No products found
because this supplier's products are not listed.
Samia Bouamama, Amina Bouamama,
bioRxiv - Pharmacology and Toxicology 2022
Quote:
An enzyme-linked immunosorbent assay (ELISA) kit was used to determine the levels of IL-2 cytokine released in PBMC free supernatants (Abfrontier, Multiplex Human Cytokine ELISA Kit).
-
No products found
because this supplier's products are not listed.
Mizuho Nosaka, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... tPA (Mouse tPA ELISA Kit, PA92, Oxford Biomedical Research, Rochester Hills, MI), uPA (Active mouse uPA Functional Assay Kit ...
-
No products found
because this supplier's products are not listed.
Martijn R. Molenaar, et al.,
bioRxiv - Biochemistry 2019
Quote:
... Human LRAT peptide (AA 1-39) was synthesized by Bio-Synthesis (Lewisville, Texas, USA).
-
No products found
because this supplier's products are not listed.
Cheng Wu, et al.,
bioRxiv - Neuroscience 2020
Quote:
... Microglass pipettes filled with 1 μl Aβ-555 peptide solution were connected to a microinjection system (BASi, USA). Aβ40-555 were used among hypertension groups and Aβ42 555 were used among APP/PS1 groups ...
-
No products found
because this supplier's products are not listed.
Sara R Roig, et al.,
bioRxiv - Cell Biology 2021
Quote:
The following peptides were purchased from EMC microcollections GmbH ...
-
No products found
because this supplier's products are not listed.
Rachel J. Harding, et al.,
bioRxiv - Biochemistry 2019
Quote:
... HTT protein was eluted with 1 cell paste volume of buffer supplemented with 250 μg/mL 3xFLAG peptide (Chempep) run twice over the anti-FLAG resin ...
-
No products found
because this supplier's products are not listed.
Sara F. Costa, et al.,
bioRxiv - Microbiology 2023
Quote:
... One microliter of each sample was mounted on a layer of 1.2% (w/v) agarose in 1:3 (vol/vol) TSB/PBS placed on a glass plate (Bio-Rad Mini-PROTEAN Short Plate) with a coverslip placed on top of each sample ...
-
No products found
because this supplier's products are not listed.
Shalini Gupta, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... The N- and C-peptides were labeled with maleimide-derivatized DY549P1 (Dyomics), DY649P1 (Dyomics) ...
-
No products found
because this supplier's products are not listed.
Qingxia Zhao, et al.,
bioRxiv - Immunology 2021
Quote:
... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.
-
No products found
because this supplier's products are not listed.
Thomas T. Thomsen, et al.,
bioRxiv - Microbiology 2021
Quote:
... from which 20 μl was spotted on solid lactose agar plates (Bromthymole Blue plates, SSI Diagnostica). Bacterial counts were recorded after overnight incubation at 37°C in ambient air ...
-
No products found
because this supplier's products are not listed.
Eric Waltari, et al.,
bioRxiv - Immunology 2019
Quote:
... The 384-well source plate (Scienion) was kept at dewpoint ...
-
No products found
because this supplier's products are not listed.
Thanh Hoang, et al.,
bioRxiv - Neuroscience 2020
Quote:
... Platinum plate electrode tweezers (Protech International Inc.) were used to deliver two 50 ms pulses (75 V with a 1 s pause between pulses ...
-
No products found
because this supplier's products are not listed.
George R. Nahass, et al.,
bioRxiv - Biochemistry 2020
Quote:
... We preloaded plates with 6 glass or silica beads (1 mm in diameter, BioSpec Products or 0.8 mm, OPS Diagnostics, respectively) per well ...
-
No products found
because this supplier's products are not listed.
Valentin Mitterer, et al.,
bioRxiv - Biochemistry 2022
Quote:
... Growth phenotypes of the mutant alleles were analysed on plates containing 1 g/l 5-fluoroorotic acid (5-FOA) (Apollo Scientific, Cat# PC4054) to select for cells that have lost the wild-type SPB4-containing URA3 plasmid ...
-
Native Antigen
Cat# NAT41587-100,
100µg USD $426.0
Ask
Maya Imbrechts, et al.,
bioRxiv - Immunology 2021
Quote:
The binding of the purified recombinant antibodies to the following SARS-CoV-2 antigens was assessed via ELISA: spike glycoprotein (S1) RBD-His (REC31849-500, The Native Antigen Company), RBD(N439K)-His (40592-V08H14 ...
-
Cat# KIT-27-B25,
25 micrograms,USD $600.0
Ask
Stephen P. Persaud, et al.,
bioRxiv - Immunology 2020
Quote:
... non-interaction of these two components was ensured by using non-biotinylated antibodies and sAV-SAP whose biotin-binding sites were occupied by an irrelevant biotinylated 11-mer peptide (BLANK Streptavidin-SAP, Advanced Targeting Systems). For experiments in which free antibody or sAV-SAP were administered alone ...
-
No products found
because this supplier's products are not listed.
Mohamad Ibrahim Cheikh, et al.,
bioRxiv - Biophysics 2022
Quote:
... plates were covered in light halocarbon oil (Halocarbon Oil 27, Sigma). Embryos with a distinctive faint halo in the periphery ...
-
No products found
because this supplier's products are not listed.
Huizhen Wang, et al.,
bioRxiv - Developmental Biology 2022
Quote:
... The plate was mounted in a Chamlide (Quorum Technology, Inc. Guelph, ON, Canada) TC-L stage top environmental chamber to maintain temperature at 37°C and a CO2 level of 5% ...
-
No products found
because this supplier's products are not listed.
Stephanie N. Langel, et al.,
bioRxiv - Immunology 2021
Quote:
... the plate was washed and SULFO-TAG (MSD) anti-hamster IgA (Brookwood Biomedical) detection antibody was added ...
-
No products found
because this supplier's products are not listed.
Shabnam Ghiasvand, et al.,
bioRxiv - Neuroscience 2022
Quote:
6-well tissue culture plates were transferred to an interface chamber (Bioscience Tools) connected to a temperature controller maintaining temperature at 37 °C and a blood gas providing 5% CO2 ...
-
No products found
because this supplier's products are not listed.
Melpomeni Platani, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Screened compounds were selected from the appropriate chemical library plates containing Cloud library (Enamine) and an in-house library of publicly available compounds ...
-
No products found
because this supplier's products are not listed.
Trayambak Pathak, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... Then the plate was kept in YSI 7100 multichannel biochemistry analyzer (YSI Life Sciences), to measure glucose and lactate levels in the media ...
-
No products found
because this supplier's products are not listed.
Chang-Yu Chen, et al.,
bioRxiv - Immunology 2021
Quote:
... The endotoxin level of HMGN1 (< 1 endotoxin unit per mg) was assessed by Endospecy ES-50M Kit (Seikagaku Corporation, Japan). The protein sequence of HMGN1 was identified by Applied Biosystems Procise 492 HT (Thermo Fisher Scientific ...
-
No products found
because this supplier's products are not listed.
Keito Okazaki, et al.,
bioRxiv - Cancer Biology 2020
Quote:
... A Histofine Kit (Nichirei Biosciences), which employs the streptavidin-biotin amplification method ...
-
No products found
because this supplier's products are not listed.
Monika Wimmer, et al.,
bioRxiv - Cancer Biology 2020
Quote:
... cells were seeded into 6-well plates containing pre-warmed antibiotic-free CnT-Prime Epithelium Culture Medium (CELLnTEC).
-
No products found
because this supplier's products are not listed.
Norman Zielke, et al.,
bioRxiv - Cell Biology 2020
Quote:
... The founder males of the second cross were transferred to 96-well plates and lysed with microLYSIS-PLUS (Cambio) according to the manufacturer’s protocol ...
-
No products found
because this supplier's products are not listed.
Jiang-An Yin, et al.,
bioRxiv - Genomics 2023
Quote:
... Viral titers of the sgRNA libraries were determined by a 6-point dose response in 6-well plates by puromycin selection and determination of live and dead cells (T.spiezzo, Cellecta) or flow cytometry of RFP+ cells (Brunello ...
-
No products found
because this supplier's products are not listed.
Hui Chen, et al.,
bioRxiv - Synthetic Biology 2023
Quote:
... plastic culture plates were coated with 20% Matrigel Matrix (CB40230C) and cells were plated in plating medium (BioIVT Z990003). After 4 h ...
-
No products found
because this supplier's products are not listed.
Lesia Rodriguez, et al.,
bioRxiv - Plant Biology 2022
Quote:
... affinity-purified TMK1 (1:1000, 59), AHA2 (1:1000, 73) and PIN2 (1:1000, 35) antibodies and anti-ROP6 (C) (1:1000, Abiocode), using anti-Rabbit HRP-conjugated (1:5000 ...
-
No products found
because this supplier's products are not listed.
Ricardo J. Ferreira, et al.,
bioRxiv - Microbiology 2021
Quote:
... coli gyrase supercoiling assay kit from Inspiralis (Norwich Research Park ...
-
No products found
because this supplier's products are not listed.
Manami Suzuki-Karasaki, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... 1 μM OxiOrangeTM or 1 μM HydropTM (Goryo Chemicals, Sapporo, Japan) for 20 min ...
-
No products found
because this supplier's products are not listed.
Timo Baade, et al.,
bioRxiv - Cell Biology 2023
Quote:
... 6 (mouse monoclonal, D14HD11, Aldevron; WB 1:6000, IF 1:200); mouse monoclonal anti 6xHis (mouse monoclonal ...
-
No products found
because this supplier's products are not listed.
Charlie J. Childs, et al.,
bioRxiv - Bioengineering 2023
Quote:
... Human Fibrinogen 1 Plasminogen Depleted (Enzyme Research Lab Cat#FIB-1), and X-Vivo 20 (Lonza Cat#190995) ...
-
No products found
because this supplier's products are not listed.
Xiaoquan Zhu, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... and concentrated using ViraTrap lentivirus purification kit (Biomiga). NIH3T3 or RWPE-1 cells or PC3 or LNCaP at 90% confluence were infected with Lenti-FOXP2 ...
-
No products found
because this supplier's products are not listed.
Loretah Chibaya, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... A commercially available cdGMP detection kit (Lucerna Technologies) was used to quantify cdGMP encapsulation ...
-
No products found
because this supplier's products are not listed.
Alaina H. Willet, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Colonies were then grown up in YE and plated on YE plates containing 1.5 mg/mL of 5-fluoroorotic acid (United States Biological; cat# F5050). Integrants were validated by colony PCR and all constructs and integrants were sequenced to ensure their accuracy.
-
No products found
because this supplier's products are not listed.
Benjamin Ng, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... using the Quickzyme Total Collagen assay kit (Quickzyme Biosciences).
-
No products found
because this supplier's products are not listed.
Mark E. Corkins, et al.,
bioRxiv - Evolutionary Biology 2022
Quote:
... then moved to a 1.5ml tube containing 1:1 1xMMR:Optiprep (Cosmo Bio Usa Inc AXS1114542) with a glass pipette ...
-
No products found
because this supplier's products are not listed.
Aviad Ben-Shmuel, et al.,
bioRxiv - Immunology 2021
Quote:
... Rabbit anti-pSHP-1 (S591) (ECM Biosciences), Rabbit anti-pPLCγ1 (Y783 ...
-
No products found
because this supplier's products are not listed.
Maximiliano José Nigro, et al.,
bioRxiv - Neuroscience 2022
Quote:
... Rabbit IgG anti-SST (1:1000, BMA Biomedicals), Rabbit IgG anti-VIP (1:1000 ...
-
No products found
because this supplier's products are not listed.
Mohammed Samer Shaban, et al.,
bioRxiv - Immunology 2020
Quote:
... and Dylight488-conjugated (ImmunoReagents #DkxMu-003D488NHSX, 1:100) secondary antibodies were used ...
-
No products found
because this supplier's products are not listed.
Joseph I Aubee, et al.,
bioRxiv - Microbiology 2024
Quote:
... All PCR reactions were purified using The Column-PureTM Clean-Up Kit (Lamda Biotech), according to the manufacturer’s instructions (Lamda Biotech).