-
No products found
because this supplier's products are not listed.
Shaibu Oricha Bello, et al.,
bioRxiv - Pharmacology and Toxicology 2022
Quote:
... Neutral red (3-amino-7-dimethylamino-2-methyl-phenazine hydrochloride) (Solarbio, cat. N8160), Minimal Essential Medium/Earls Balance Salts (MEM/EBSS ...
-
No products found
because this supplier's products are not listed.
Alexandre Giraud-Gatineau, et al.,
bioRxiv - Immunology 2019
Quote:
... coverslips were set in Fluoromount G medium containing 1 µg/ml 4′,6-diamidino-2-phenylindole (DAPI) (SouthernBiotech, Birmingham, Alabama) on microscope slides ...
-
Cat# HY-W013014-500 mg,
500 mg, USD $50.0
Ask
Meghan L Bucher, et al.,
bioRxiv - Neuroscience 2023
Quote:
1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (MPTP) (Sigma or MedChemExpress) was administered according to a 5 × 20mg/kg dosing paradigm ...
-
No products found
because this supplier's products are not listed.
LN Marziali, et al.,
bioRxiv - Neuroscience 2023
Quote:
... the cells were incubated with 4’,6-diamidino-2-phenylindol (DAPI; 1 μg/ml) and the corresponding Alexa Fluor-conjugated secondary antibodies (1:500; Jackson ImmunoResearch Laboratories) for 2 h at RT ...
-
No products found
because this supplier's products are not listed.
Emily J. Talbot, et al.,
bioRxiv - Cell Biology 2023
Quote:
... 4 µM digitonin) with or without 7 µM 2’,3’-cGAMP (Invivogen). Cells were further washed in PBS and incubated in culture medium until collection ...
-
No products found
because this supplier's products are not listed.
Juliane Mietz, et al.,
bioRxiv - Immunology 2023
Quote:
... Wells were washed and incubated for 2 hours with biotinylated anti-IFN-ψ detection antibody (mAb-7-B6-1-Biotin, Mabtech, Cat. 3420-6-250). Afterwards ...
-
No products found
because this supplier's products are not listed.
Alexandra Sockell, et al.,
bioRxiv - Bioengineering 2022
Quote:
High-resolution time-lapse images for experiments #1-6 (Figs. 2-4) were acquired on an inverted fluorescence microscope (Nikon Ti) with a motorized xy-stage (ASI MS-2000 ...
-
No products found
because this supplier's products are not listed.
Maria Kristina Parr, et al.,
bioRxiv - Pharmacology and Toxicology 2019
Quote:
... PC) and ecdysone (2β,3β,14α,22R,25-pentahydroxy-5β-cholest-7-en-6-one, 1) were purchased from Steraloids (Newport, USA), while ponasterone (2β,3β,14α,20β,22R-pentahydroxy-5β-cholest-7-en-6-one ...
-
No products found
because this supplier's products are not listed.
Besir Krasniqi, et al.,
bioRxiv - Microbiology 2020
Quote:
... K22 [(Z)-N-[3-[4-(4-bromophenyl)-4-hydroxypiperidin-1-yl]-3-oxo-1-phenylprop-1-en-2-yl]benzamide;16 from ChemDiv] and GS-441524 (the nucleoside form of remdesivir; from Carbosynth). After five days incubation at 35°C ...
-
No products found
because this supplier's products are not listed.
Eva M. Steiner-Rebrova, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... casΦ-2 of Biggiephage (22), a short, non-CIS related AMPs, human ll-37 (Uniprot: P49913, ‘[LL-37, 37 aa]’) afp18ΔC8 from Genscript. The two non-CIS cargos ll-37 and casΦ-2 were cloned into the designed afp18 N-terminal constructs including the first 50 ...
-
No products found
because this supplier's products are not listed.
Alejandra Arias-Cavieres, et al.,
bioRxiv - Neuroscience 2019
Quote:
... manganese (III) tetrakis(1-methyl-4-pyridyl) porphyrin (MnTMPyP, Enzo Life Sciences, CAT #: ALX-430-070), was administered via intraperitoneal injection at the beginning of each day prior to exposure to IH ...
-
No products found
because this supplier's products are not listed.
Bethany C. Taylor, et al.,
bioRxiv - Systems Biology 2024
Quote:
... according to the Ovation RRBS Methyl-Seq System 1-16 protocol for the first read and the Read 2 primer (Illumina) for the second read ...
-
No products found
because this supplier's products are not listed.
Briana Christophers, et al.,
bioRxiv - Developmental Biology 2023
Quote:
... Ventral longitudinal muscle 6 in abdominal segments 3 or 4 was impaled with two intracellular electrodes (1 mm outer diameter borosilicate capillaries; World Precision Instruments, 1B100F-4) of ∼15 MΩ resistance (3M KCl) ...
-
Prepared to contain collagenase and caseinase activities approximately four-fold higher than...
Cat# LS005332,
100 mg, $68.00
Ask
Nisha Venugopal, et al.,
bioRxiv - Cell Biology 2019
Quote:
... muscle of 6-week old male C57 BL/7 mice was dissected out and treated with Collagenase Type 1 (Cat# LS4196 Worthington 400U/ml final concentration) for 1 hour at 37°C ...
-
No products found
because this supplier's products are not listed.
Ron Refaeli, et al.,
bioRxiv - Neuroscience 2023
Quote:
... the relevant brain slices were incubated for 7 days at 4#x00B0;C with rabbit anti-cFos primary antibody (1:10000, Synaptic system, #226003), and for the mCherry staining ...
-
No products found
because this supplier's products are not listed.
Helmut Bischof, et al.,
bioRxiv - Cancer Biology 2023
Quote:
Glucose uptake was assessed using 2-(N-(7-Nitrobenz-2-oxa-1,3-diazol-4-yl)Amino)-2-Deoxyglucose (2- NBDG) (Biomol GmbH). Therefore ...
-
No products found
because this supplier's products are not listed.
Kristen A. Gaffney, et al.,
bioRxiv - Biophysics 2021
Quote:
... iodoacetyl-7-nitrobenz-2-oxa-1,3-diazol (IA-NBD, Setareh Biotech) (42) ...
-
No products found
because this supplier's products are not listed.
Erica A. Birkholz, et al.,
bioRxiv - Microbiology 2021
Quote:
... 4-7 µl of cells were deposited on R2/1 Cu 200 grids (Quantifoil) that had been glow-discharged for 1 min at 0.19 mbar and 20 mA in a PELCO easiGlow device shortly before use ...
-
No products found
because this supplier's products are not listed.
Zachary H. Walsh, et al.,
bioRxiv - Immunology 2023
Quote:
... with substitution of N-1-methyl-pseudouridine-5’-triphosphate (TriLink Biotechnologies, #N-1081-1) for UTP and co-transcriptional capping with CleanCap® Reagent AG (TriLink Biotechnologies ...
-
No products found
because this supplier's products are not listed.
Bogdan B. Grigorash, et al.,
bioRxiv - Cell Biology 2022
Quote:
... Keratin 7 (Genetex #GTX110414; 1:250), Keratin 8 (DSHB Hybridoma Product TROMA-I ...
-
No products found
because this supplier's products are not listed.
Mingyue Li, et al.,
bioRxiv - Microbiology 2021
Quote:
... 10 μg·ml-1 anti-IL-4 and 10 μg·ml-1 anti-IL-2 (Bio X Cell, Cat# BE0043-1, RRID:AB_1107705). For Treg cell differentiation ...
-
No products found
because this supplier's products are not listed.
Federico Cocozza, et al.,
bioRxiv - Cell Biology 2023
Quote:
... 10% and 6% and ultracentrifuged at 187,000xg for 1:30h at 4°C in Sw32.1Ti rotor (Beckman Coulter). Afterwards ...
-
No products found
because this supplier's products are not listed.
JS Cho, et al.,
bioRxiv - Pathology 2024
Quote:
... Isotype controls or fluorescence minus one (FMO) controls were used, and the live/dead marker 7-aminoactinomycin D (7-AAD, PerCP) (Miltenyi Biotec) was added to all samples 10 min before analysis (10 μl to 1 ml of cell suspension).
-
No products found
because this supplier's products are not listed.
Bibiana Rius, et al.,
bioRxiv - Biochemistry 2020
Quote:
... 1.6 mM BTTAA ligand (2-(4-((bis((1-tert-butyl-1H-1,2,3-triazol-4-yl)methyl)amino)methyl)−1 H-1,2,3-triazol-1-yl)acetic acid) (Click Chemistry Tools Scottsdale, Az), and 5 mM sodium ascorbate ...
-
No products found
because this supplier's products are not listed.
Franziska C. Durst, et al.,
bioRxiv - Molecular Biology 2019
Quote:
... Isolated cells were picked in 1 μl of 1× PBS and transferred into 4.4 μl of lysing buffer containing 4 μl mTRAP™ Lysis Buffer (Active Motif) and 0.4 μl (10 ng ...
-
No products found
because this supplier's products are not listed.
Isabel Kurth, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... received one dose of 1 mg/kg creatine-(methyl-d3) (DLM-1302-0.25, Cambridge Isotope Laboratories, Tewksbury, MA) by i.p ...
-
No products found
because this supplier's products are not listed.
Icaro Putinhon Caruso, et al.,
bioRxiv - Biophysics 2021
Quote:
... Samples of 20 μΜ N-NTD or N-NTD-SR consisting of varied protein:nucleic acid molar ratios (8:1, 4:1, 2:1, 1:1, 1:2) were prepared in low-binding microtubes (Eppendorf® LoBind) in the presence of 10% PEG-4000 (w/v ...
-
1-methyl-7-nitroisatoic anhydride (1M7) is a commonly applied RNA-SHAPE electrophile for probing...
Cat# S0310, SKU# S0310-5mg,
5mg, $270.00
Ask
Michael A. Carpenter, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... 4 μM cisplatin (cis-diamminedichloroplatinum II, Selleck Chemical) was incubated with cells for 24 hrs ...
-
No products found
because this supplier's products are not listed.
Alexandria N. Miller, et al.,
bioRxiv - Biophysics 2022
Quote:
... 1 mM 4-(2-Aminoethyl)-benzenesulfonylfluoride hydrochloride (AEBSF, Gold Biotechnology), 1 mM benzamidine hydrochloride monohydrate (benzamidine ...
-
No products found
because this supplier's products are not listed.
Alix Goupil, et al.,
bioRxiv - Developmental Biology 2021
Quote:
... two different protocols were used: 1) one step of O/N incubation at 4°C with GFP booster (1:250, Alexa Fluor ® 488 Chromotek #gb2AF488), Phalloidin-647 (1:250 ...
-
No products found
because this supplier's products are not listed.
Yoichi Araki, et al.,
bioRxiv - Neuroscience 2020
Quote:
... and time-lapse images were acquired with either LSM510 (Carl Zeiss; Fig. 1, 4, and 6) or Spinning disk confocal microscopes controlled by axiovision software (Carl Zeiss ...
-
No products found
because this supplier's products are not listed.
Nirupa Nagaratnam, et al.,
bioRxiv - Biochemistry 2022
Quote:
... and 6-cyclohexyl-1-hexyl-β-D-maltoside (Cymal-6) (Anatrace). Briefly ...
-
No products found
because this supplier's products are not listed.
Wenjing Zhang, et al.,
bioRxiv - Cell Biology 2023
Quote:
... The membranes were then incubated with the following primary antibodies at 4°C for 6 h: GAPDH (1:6000, no. A19056), vinculin (1:1000, A2752) (ABclonal Technology, Co., China), caspase-3 (1:1000 ...
-
No products found
because this supplier's products are not listed.
Jerry Yan, et al.,
bioRxiv - Bioengineering 2023
Quote:
... Plates were then blocked with 1% non-fat dry milk (Rockland) for 1h at RT ...
-
No products found
because this supplier's products are not listed.
Jian-You Lin, et al.,
bioRxiv - Neuroscience 2021
Quote:
... one of 4 gustatory stimuli (0.1M NaCl, 0.3M Sucrose ...
-
No products found
because this supplier's products are not listed.
Lena H. Nguyen, et al.,
bioRxiv - Neuroscience 2021
Quote:
... using pulled borosilicate glass pipettes (4-7 MΩ resistance, Sutter Instrument) filled with an internal solution (in mM ...
-
No products found
because this supplier's products are not listed.
Hafez el Sayyed, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... pco.edge 4.4 sCMOS cameras (PCO) and a 60x oilimmersion objective (Olympus PlanApo 1.42 NA). An area of 512×512 pixels was used to acquire a stack of 125-nm sections to generate a total of 2-3 μm thickness ...
-
No products found
because this supplier's products are not listed.
Olga Puchta, et al.,
bioRxiv - Synthetic Biology 2020
Quote:
Microarray imaging was performed in an imaging buffer solution containing fluorophore DFHBI-1T ((Z)-4-(3,5-difluoro-4-hydroxybenzylidene)-2-methyl-1-(2,2,2-trifluoroethyl)-1Himidazol-5(4 H)-one) (excitation = 472 nm, emission = 507 nm)) from Lucerna Technologies Cat ...
-
No products found
because this supplier's products are not listed.
Philipp Gaugler, et al.,
bioRxiv - Plant Biology 2022
Quote:
... They were then diluted 1:200 in 2 mL fresh medium supplemented with 6 μCi mL−1 [3H]-myo-inositol (30–80 Ci mmol−1; Biotrend; ART-0261-5) and grown overnight at 28°C in a spinning wheel ...
-
No products found
because this supplier's products are not listed.
Alexandra V. Vylegzhanina, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... 1 hour at room temperature or 2) rabbit anti-human ORF1p polyclonal serum in 1% non-fat dry milk (RPI) in TBST in dilution 1:1,000 ...
-
No products found
because this supplier's products are not listed.
Karol Fiedorczuk, Jue Chen,
bioRxiv - Biophysics 2021
Quote:
... in the presence of varying concentrations of lumacaftor (at 1:1 molar ratio of cold and [3H] lumacaftor (6.4 Ci/mmol, synthesized by Moravek) in buffer containing 20 mM Tris-HCl pH 7.5 ...
-
No products found
because this supplier's products are not listed.
Brian T. Do, et al.,
bioRxiv - Cancer Biology 2024
Quote:
... with a 4:2:1:1 ratio of the target:pMDLg:pMD2.G:pRSV-REV plasmids using Transit 293T reagent (Mirus). After 48 hours ...
-
No products found
because this supplier's products are not listed.
Alison Dumont, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... Caspase 3/7 dye (4440, Sartorius, 1/1000) and/or propidium Iodide (PI ...
-
No products found
because this supplier's products are not listed.
Catharina Donkels, et al.,
bioRxiv - Neuroscience 2024
Quote:
... and non-specific polyclonal rabbit IgG (1 µg, Diagenode), overnight at 4°C under constant rotation ...
-
No products found
because this supplier's products are not listed.
Yuki Takamatsu, Takeshi Noda, Stephan Becker,
bioRxiv - Molecular Biology 2019
Quote:
A total of 2×104 Huh-7 cells were seeded onto a µ-Slide 4 well (Ibidi) and cultivated in DMEM/PS/Q with 10% FBS ...
-
No products found
because this supplier's products are not listed.
Yue Qu, et al.,
bioRxiv - Neuroscience 2021
Quote:
The completed constructs in M-6-attB-UAS-1-3-4 vector were amplified in Epi300 competent cells (EpiCentre) in LB-Chloramphenicol medium ...
-
No products found
because this supplier's products are not listed.
Alexander J. Stemm-Wolf, et al.,
bioRxiv - Cell Biology 2021
Quote:
... 1:2000 α-SAS-6 (Bethyl A301-802A); 1:500 α-CPAP (Proteintech CENPJ 11517-1-AP) ...
-
No products found
because this supplier's products are not listed.
Joonyong Lee, et al.,
bioRxiv - Physiology 2021
Quote:
... Serum IGF2 levels were quantified using a 1/6 dilution with the Mouse IGF-2 ELISA Kit (Boster Biological Technology, EK0381) as per directions by the manufacturer and read with the SpectraMax M2e spectrophotometer using the SoftMax Pro 6 program.
-
No products found
because this supplier's products are not listed.
Charlotte H. Hurst, et al.,
bioRxiv - Plant Biology 2023
Quote:
... Calnexin 1/2 (Agrisera AS12 2365) and UDP-glucose pyrophosphorylase (Agrisera AS05 086 ...
-
No products found
because this supplier's products are not listed.
Sawsan S Alamri, et al.,
bioRxiv - Immunology 2021
Quote:
... were coated overnight at 4°C with the SARS-CoV-2 S1 subunit (amino acids 1–685) (Sino Biological, China) at 1 μg/ml in PBS (50 ul/well) ...