-
No products found
because this supplier's products are not listed.
Rosalie Sinclair, et al.,
bioRxiv - Plant Biology 2023
Quote:
... 50 μM endosiden 7(ES7) (ChemBridge) (or otherwise indicated concentration ...
-
No products found
because this supplier's products are not listed.
Julia Ledderose, et al.,
bioRxiv - Neuroscience 2021
Quote:
... Time-pregnant female mice were injected intraperitoneally with 50 mg/kg BrdU (5-bromo-2’-deoxyuridine, BrdU; Accurate Chemical & Scientific Corporation) at E11.5 ...
-
No products found
because this supplier's products are not listed.
C. Fung, et al.,
bioRxiv - Neuroscience 2021
Quote:
... GLP-1 (7-36)-amide (Phoenix Pharmaceuticals), CCK-8 (PolyPeptides Laboratories) ...
-
Cat# 24246-14-8,
Inquire
Ask
Alexandra Gros, et al.,
bioRxiv - Neuroscience 2023
Quote:
... These rats also received one intraperitoneal injection of 5-Bromo-2’-deoxyuridine (BrdU, 200 mg/kg in 0.9% NaCl, BOC Sciences 59-14-3) 24h before sacrifice to study adult newborn cell proliferation after several days of simulated microgravity exposure and to reduce the number of animals used for this study.
-
No products found
because this supplier's products are not listed.
Nayab Fatima, et al.,
bioRxiv - Neuroscience 2020
Quote:
Primary human astrocytes (passage 2-7) obtained from ScienCell were cultured in astrocyte medium (ScienCell ...
-
No products found
because this supplier's products are not listed.
Barbara J. Mann, et al.,
bioRxiv - Microbiology 2022
Quote:
... primed 7-day Alzet® osmotic pumps (Durect, Cuperton, CA) containing saline or drug were implanted subcutaneously (McCray et al. ...
-
No products found
because this supplier's products are not listed.
Bo Liang, et al.,
bioRxiv - Microbiology 2020
Quote:
... KCl (CAS 7447-40-7) (Spectrum Chemicals, New Brunswick, NJ) and water ...
-
No products found
because this supplier's products are not listed.
Yukitoshi Izumi, et al.,
bioRxiv - Neuroscience 2024
Quote:
... Finasteride (CAS#:98319-26-7) was from Steraloids (Newport RI).
-
No products found
because this supplier's products are not listed.
Kristen A. Gaffney, et al.,
bioRxiv - Biophysics 2021
Quote:
... iodoacetyl-7-nitrobenz-2-oxa-1,3-diazol (IA-NBD, Setareh Biotech) (42) ...
-
No products found
because this supplier's products are not listed.
Davia Blake, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... Caspase-3/7 activity was measured with FAM-FLICA probes (Immunochemistry Technologies: 93) and MOMP events were measured with MitoTracker Red CMXRos staining (ThermoFisher ...
-
No products found
because this supplier's products are not listed.
Adriana Blazeski, et al.,
bioRxiv - Bioengineering 2023
Quote:
... at passage 7 were maintained in FibroLife S2 Fibroblast Medium (Lifeline Cell Technology) and cultured until 50-70% confluency prior to use in MVNs ...
-
No products found
because this supplier's products are not listed.
Caroline Passaes, et al.,
bioRxiv - Immunology 2019
Quote:
... Culture supernatants were assayed on day 7 using an SIV p27 Antigen ELISA Kit (Zeptometrix). Antiviral activity was calculated as log10 (mean p27 ng/mL in SIV-infected CD4+ T-cell cultures without CD8+ T-cells ...
-
No products found
because this supplier's products are not listed.
Luca M. Zaeck, et al.,
bioRxiv - Microbiology 2020
Quote:
... Nasal conchae were furthermore decalcified for 4-7 days in Formical-2000™ (Statlab, USA). Samples were trimmed to the sizes and volumes described above ...
-
No products found
because this supplier's products are not listed.
In-Hyuk Jung, et al.,
bioRxiv - Genetics 2020
Quote:
... 50 µg ml-1 human medium oxidized low density lipoprotein (oxLDL, #770202-7, Kalen biomedical) was used.
-
No products found
because this supplier's products are not listed.
Xiangyu Zhou, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... succinyl-Leu-Leu-Val-Tyr-7-amino-4-methylcoumarin (Suc-LLVY-MCA; Peptide Institute, Cat#3120-v) in 100 mM Tris-HCl (pH 8.0 ...
-
No products found
because this supplier's products are not listed.
Galit H. Frydman, et al.,
bioRxiv - Immunology 2019
Quote:
... 10 µL of cells were then imaged on a disposable C-Chip hemocytometer (In Cyto, SKC, Inc. C-Chip) using a 10X and 20X objective on a Nikon TiE fluorescent microscope ...
-
No products found
because this supplier's products are not listed.
Marta F. M. Vieira, et al.,
bioRxiv - Biophysics 2021
Quote:
All constructs (C-Tir, C-SH2, N-Tir, and NS-Tir) were sub-cloned into the pHTP8 plasmid (NZYTech), bearing a cleavable His6-tagged thioredoxin tag (TRX-His6 ...
-
No products found
because this supplier's products are not listed.
Lawrence G. Welch, et al.,
bioRxiv - Cell Biology 2021
Quote:
... Cells were incubated with a panel of 7 fluorescein-labelled lectins (final concentration 20 μg/mL, Vector Biolabs) and a fixable viability dye eFluor 780 (1:1000 ...
-
No products found
because this supplier's products are not listed.
Sonu Kumar, et al.,
bioRxiv - Microbiology 2020
Quote:
The SEC-purified Fab M4H2K1 and complex were each concentrated to 12 mg/ml before being screened at both 4 °C and 20 °C using our high-throughput CrystalMationTM robotic system (Rigaku) at TSRI (103) ...
-
No products found
Ashaq Hussain, Malay Kumar Ray,
bioRxiv - Microbiology 2022
Quote:
... syringae Lz4W was routinely grown at 22°C or 4°C (for optimum and low temperatures respectively) in Antarctic bacterial medium (ABM) composed of 5 g/l peptone and 2.0 g/l yeast extract ...
-
No products found
because this supplier's products are not listed.
Shane Austin, et al.,
bioRxiv - Biochemistry 2021
Quote:
... LETM1 C-terminal region (Aviva, Systems Biology, #OAAB12878), 1:1000 ...
-
No products found
because this supplier's products are not listed.
Xiufang Kong, Amr H Sawalha,
bioRxiv - Genetics 2019
Quote:
... on the Omega Lum C imaging system (Gel Company).
-
No products found
because this supplier's products are not listed.
Kenneth Johnson, et al.,
bioRxiv - Microbiology 2022
Quote:
... at 37°C in flow chambers (IBI scientific, UK). The system was sterilized by pumping a 0.2 % of hypochlorite solution for 1 hour using a peristaltic pump ...
-
No products found
because this supplier's products are not listed.
Yongtao Wang, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Using 7550-1-C ceramic blades (Campden Instruments Limited), the tissue was cut into 250 μm slices at an advance speed of 0.1 mm/s ...
-
No products found
because this supplier's products are not listed.
Fabian Stefan Franz Hartmann, et al.,
bioRxiv - Microbiology 2021
Quote:
... Spotting was conducted by setting an overshoot of 1.5 mm and a pin-pressure of 7 % using long 96-well pins (Singer Instruments). To avoid reflection from the plastic edges of the OmnyTray plates as well as effects resulting from the outer barrier of arrayed colonies ...
-
No products found
because this supplier's products are not listed.
Vanessa Krauspe, et al.,
bioRxiv - Microbiology 2020
Quote:
... Gels were stained using either 20 mM zinc sulfate-7-hydrate for reversible zinc staining of chromophores and/or InstantBlue(tm) Coomassie staining (Expedeon). Otherwise ...
-
No products found
because this supplier's products are not listed.
Weimin Lin, et al.,
bioRxiv - Cell Biology 2021
Quote:
... The antibodies respectively are anti-C/EBPα (ZEN BIO, 383901) and anti-FoxO1 (ZEN BIO ...
-
No products found
because this supplier's products are not listed.
Adam L. Fellows, et al.,
bioRxiv - Cell Biology 2023
Quote:
Confluent HPAECs were treated with CTC (Cambridge Bioscience, C-2951) at a concentration of 100μM (unless otherwise stated) ...
-
No products found
because this supplier's products are not listed.
Christin Herrmann, et al.,
bioRxiv - Microbiology 2020
Quote:
... with 0.15% v/v TFA and separated into either 3 high-pH fractions (enriched ubiquitinated peptides) or 7 high-pH fractions (global proteome) over C18 columns (The Nest Group, MicroSpin column C18 silica ...
-
No products found
because this supplier's products are not listed.
Anne Billet, et al.,
bioRxiv - Biochemistry 2023
Quote:
... 10 mg crude was reacted with 1.1 equivalent of commercial DBCO-Mal (Iris biotech; CAS: 1395786-30-7; MW 427.45 g/mol) or DBCO-PEG4-Mal (Iris biotech ...
-
No products found
because this supplier's products are not listed.
Blandine Madji Hounoum, et al.,
bioRxiv - Cell Biology 2023
Quote:
... rinsed and postfixed in 1% osmium tetroxide and 1% potassium ferrocyanide in 0.1M cacodylate buffer before to processed for ultrastructure as previously described [7] and analyzed using a JEOL JEM1400 transmission electron microscope (JEOL, Tokyo, Japan).
-
No products found
because this supplier's products are not listed.
Margaret M. McDaniel, Vitaly V. Ganusov,
bioRxiv - Immunology 2019
Quote:
... We fitted either recirculation model (panels A&C, see eqns. (3)–(9) ...
-
No products found
because this supplier's products are not listed.
Zachary B. Hancock, et al.,
bioRxiv - Evolutionary Biology 2020
Quote:
Whole genomic DNA was extracted from either the whole specimen or pereopods 6–7 depending on the size of the amphipod using an EZNA Tissue DNA kit (Omega Bio-tek Inc.) following manufacturer’s protocols ...
-
No products found
because this supplier's products are not listed.
Ignasi Casanellas, et al.,
bioRxiv - Bioengineering 2021
Quote:
... immunostained with anti-C×43 antibody and Sir-Actin (Tebu-bio, SC001), and imaged with a Zeiss LSM780 Confocal Microscope (Zeiss Microscopy ...
-
No products found
because this supplier's products are not listed.
Alice Main, et al.,
bioRxiv - Cell Biology 2022
Quote:
... PSI-6679), fast skeletal-MyBP-C (1:1000, MYBPC2, Caltag Medsystem (ProSci), PSI-5651) ...
-
No products found
because this supplier's products are not listed.
Zsuzsa Radvanyi, et al.,
bioRxiv - Physiology 2023
Quote:
... The intact-FGF23 and c-terminal FGF23 were measured by ELISAs (Quidel, Cat ...
-
No products found
because this supplier's products are not listed.
Julia Fath, et al.,
bioRxiv - Cell Biology 2022
Quote:
... with 1 μM TAMRA-sheperdin-C-ter BDNF (TAMRA-KHSSGCAFLKKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France), or with TAMRA fluorophore alone for 20 minutes ...
-
No products found
because this supplier's products are not listed.
Mathieu Métivier, et al.,
bioRxiv - Cell Biology 2020
Quote:
... dialyzed overnight in PBS at 4°C and used for guinea pig immunization (Covalab).
-
No products found
because this supplier's products are not listed.
Emilie Logie, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... After overnight incubation at 4°C with the primary FOXA1 antibody (13-2001, Epicypher), cell-bead slurry was washed twice more after which pA-MNase digestion was activated by placing samples on an ice-cold block and incubated with digitonin wash buffer containing 2 mM CaCl2 ...
-
No products found
because this supplier's products are not listed.
Martin Dlask, et al.,
bioRxiv - Biophysics 2019
Quote:
We used a measurement system based on cooled (−30 °C) low-noise photomultiplier tube (PMT) R2256-02 (all components of the system from Hamamatsu Photonics Deutschland ...
-
No products found
because this supplier's products are not listed.
Klaudia K. Maruszczak, et al.,
bioRxiv - Biochemistry 2022
Quote:
... 4°C) and the clarified supernatant was applied to a nickel affinity resin column (Cube Biotech). The column was first washed with the buffer mentioned above supplemented with 10 mM imidazole ...
-
No products found
because this supplier's products are not listed.
Juan Martín D’Ambrosio, et al.,
bioRxiv - Cell Biology 2020
Quote:
... and lysed twice with high pressure (1200 psi) at −80 °C using a cell breaker (Carver, Inc.). Lysates were cleared by centrifugation and the cleared lysates were incubated with 30 μl of IgG-coupled magnetic beads (Dynabeads ...
-
No products found
because this supplier's products are not listed.
Daniel W. Montgomery, et al.,
bioRxiv - Physiology 2021
Quote:
... The remaining plasma was snap frozen in liquid N2 and stored at −80°C before measurements of plasma lactate and glucose were made (YSI 2900D Biochemistry Analyzer ...
-
Cystatin-C ELISA / assay Kit
Cat# K012-H1,
1.0 ea, USD $385.0
Ask
Nathan Godfrey, Stephanie L. Borgland,
bioRxiv - Neuroscience 2020
Quote:
... 15 min at 4 °C and serum corticosterone (CORT) was measured with and according to manufacturer’s instructions (DetectX Corticosterone Enzyme Immunoassay Kit, Arbor Assays).
-
No products found
because this supplier's products are not listed.
Hajar Mikaeili, et al.,
bioRxiv - Neuroscience 2022
Quote:
... 7-10 µm thick) and Human Prostate Frozen Sections (HF-408, 7-10 µm thick) were obtained commercially from Zyagen (www.zyagen.com) via AMS Biotechnology (https://www.amsbio.com ...
-
No products found
because this supplier's products are not listed.
Sylwia Machcinska, et al.,
bioRxiv - Developmental Biology 2020
Quote:
... and C (CELLnTEC, Switzerland) was added per insert ...
-
No products found
because this supplier's products are not listed.
Michaela S. Matthes, et al.,
bioRxiv - Plant Biology 2024
Quote:
... 37°C) and secondary rabbit Cy3-Antibodies (BSA/PBS for 3.5h at 37°C; Jackson ImmunoResearch/USA supplied by Dianova/Hamburg). After repeated washes with PBS and H20 the embryos were embedded in Citifluor antifadent mounting medium and covered with a coverslip ...
-
No products found
because this supplier's products are not listed.
Owen J. Chen, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... MEFs were maintained at 37°C in DMEM (Wisent Bioproducts: 4.5 g/L glucose ...
-
No products found
because this supplier's products are not listed.
Jianying Zhang, et al.,
bioRxiv - Cell Biology 2020
Quote:
... the cells were incubated at 4°C with goat anti-nucleostemin overnight (1:350, Neuromics, Edina, MN). Then the cells were washed with PBS 3 times and incubated with cyanine 3 (Cy3)-conjugated donkey anti-goat IgG secondary antibody (1:500 ...
-
No products found
because this supplier's products are not listed.
Anna E Mammel, et al.,
bioRxiv - Cell Biology 2021
Quote:
... PNA probes were diluted to 50 μM in 85°C hybridization buffer (60% formamide + 20 mM Tris, pH 7.4 + 0.1 μg/mL salmon sperm DNA (Trevigen)) and coverslips were simultaneously washed at 85°C in 2x SSC ...