-
No products found
because this supplier's products are not listed.
Toby Buttress, et al.,
bioRxiv - Plant Biology 2021
Quote:
Sequences for H2B.8 and H2B.2 were cloned into the pET28a+ vector with a non-cleavable C-terminal 8×His-tag and then transformed to Escherichia coli strain BL21 (Tiangen). Cells were grown to OD 0.8 at 37 °C in LB media with 30 μg/ml kanamycin ...
-
No products found
because this supplier's products are not listed.
Rosalie Sinclair, et al.,
bioRxiv - Plant Biology 2023
Quote:
... 50 μM endosiden 7(ES7) (ChemBridge) (or otherwise indicated concentration ...
-
No products found
because this supplier's products are not listed.
Ronald Rodriguez, et al.,
bioRxiv - Microbiology 2022
Quote:
... and AMK (Ambeed, 8 μg/ml). All cultures were prepared in triplicate ...
-
No products found
because this supplier's products are not listed.
Nayab Fatima, et al.,
bioRxiv - Neuroscience 2020
Quote:
Primary human astrocytes (passage 2-7) obtained from ScienCell were cultured in astrocyte medium (ScienCell ...
-
No products found
because this supplier's products are not listed.
Daniel A. Pensinger, et al.,
bioRxiv - Microbiology 2022
Quote:
... difficile agar base (Oxoid) supplemented with 7% defibrinated horse blood (HemoStat Laboratories), 32 mg/L moxalactam (Santa Cruz Biotechnology) ...
-
No products found
because this supplier's products are not listed.
Joanna Domagala, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... MCF-7 cells were seeded on 16-well E-Plates (ACEA Biosciences) at a cell density 3 × 104 per well in 150 μl of the DMEM medium and monitored for 24h ...
-
No products found
because this supplier's products are not listed.
Mayumi K. Holly, et al.,
bioRxiv - Microbiology 2020
Quote:
... C-reactive protein (MyBioSource). The optical density was read at 450 nm on an EnVision plate reader (PerkinElmer) ...
-
No products found
because this supplier's products are not listed.
Snježana Kodba, et al.,
bioRxiv - Cell Biology 2024
Quote:
... one well of an 8-well Ibidi chambers (IBI Scientific #80807) was coated with 10 mg/mL Laminin (Sigma ...
-
No products found
because this supplier's products are not listed.
Hema Priya Mahendran, et al.,
bioRxiv - Cancer Biology 2024
Quote:
Blocking Solution: 3% Albumin Fraction V (Bio Basic; CA#9048-46-8), 0.1% Tween20 (ACP Chemicals ...
-
No products found
because this supplier's products are not listed.
Luca M. Zaeck, et al.,
bioRxiv - Microbiology 2020
Quote:
... Nasal conchae were furthermore decalcified for 4-7 days in Formical-2000™ (Statlab, USA). Samples were trimmed to the sizes and volumes described above ...
-
No products found
because this supplier's products are not listed.
Xiangyu Zhou, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... succinyl-Leu-Leu-Val-Tyr-7-amino-4-methylcoumarin (Suc-LLVY-MCA; Peptide Institute, Cat#3120-v) in 100 mM Tris-HCl (pH 8.0 ...
-
No products found
because this supplier's products are not listed.
Julia R. Port, et al.,
bioRxiv - Microbiology 2021
Quote:
The aerosol transmission system consisted of two 7” X 11” X 9” plastic hamster boxes (Lab Products, Inc.) connected with a 3” diameter tube (Supplementary Figure 1) ...
-
No products found
because this supplier's products are not listed.
Virginia Lioy, et al.,
bioRxiv - Microbiology 2021
Quote:
... suspended in TE (pH 8) with 4 μl of lysozyme (35 U/μl; Tebu Bio) for 45 min and then homogenized with a Bioruptor sonication device (3 cycles of 30 seconds ...
-
No products found
because this supplier's products are not listed.
Caterina Iorio, et al.,
bioRxiv - Cell Biology 2021
Quote:
... 16.7 mM glucose and 45mM KCl treatments were collected and insulin amount determined using a human insulin HTRF assay (Cisbio). Cells infected with lentivirus were incubated for 6 days prior to GSIS assay ...
-
No products found
because this supplier's products are not listed.
Fanny Ehret, et al.,
bioRxiv - Neuroscience 2024
Quote:
... Blood samples taken at 7 months were procced for serum collection as described before were used to measure Casp3(E-El-M0238, Elabscience) and Ill1α (EA100140 ...
-
No products found
because this supplier's products are not listed.
Mehran Najibi, et al.,
bioRxiv - Immunology 2019
Quote:
... Anti-Mucolipin 1 (MCOLN1) (C-Term) antibody (Antibodies-Online, ABIN571446). Cells were washed thrice in PBS and incubated with the fluorescent secondary antibody plus Hoechst stain (Anaspec ...
-
No products found
because this supplier's products are not listed.
Randy F. Lacey, et al.,
bioRxiv - Microbiology 2021
Quote:
... Oospore numbers were estimated using disposable C-Chip haemocytometers (Bulldog Bio). Purified oospores were stored at 4 °C in the dark.
-
No products found
because this supplier's products are not listed.
Rebecca O’Cleirigh, Roslyn Gibbs,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
... and incubated at 37°C and 5% CO2 (Nuaire, DH Autoflow). Media was changed every 48 hours and cells passaged when they reached confluence as recommended by the supplier ...
-
No products found
because this supplier's products are not listed.
Kelly Snead, et al.,
bioRxiv - Biochemistry 2022
Quote:
... at 4°C using 40µL bed volume (BV) nickel-charged IMAC tips (Biotage, Uppsala, Sweden). The columns were washed in a 96-well deepwell plate with 20BV dH2O and then equilibrated in 20BV of 20mM HEPES pH 7.4 ...
-
No products found
because this supplier's products are not listed.
D. Wünkhaus, et al.,
bioRxiv - Cell Biology 2023
Quote:
... ML-SA5 (Enamine Ltd., 2418670-70-7), Bafilomycin A (Sigma ...
-
No products found
because this supplier's products are not listed.
Huifang Bai, et al.,
bioRxiv - Zoology 2021
Quote:
... Records were selected systematically from 7 databases (Medline via to Pubmed ...
-
No products found
because this supplier's products are not listed.
Iosifina P. Foskolou, et al.,
bioRxiv - Immunology 2022
Quote:
... the human KDM4C enzyme (8 nM, BPS Bioscience) was incubated with the substrate of H3(1-21 ...
-
No products found
because this supplier's products are not listed.
Andre Machado Xavier, et al.,
bioRxiv - Neuroscience 2022
Quote:
... using a 7 ml dounce tissue grinder (DWK Life Sciences, 357542) as performed in Gosselin et al ...
-
No products found
because this supplier's products are not listed.
Kristen A. Gaffney, et al.,
bioRxiv - Biophysics 2021
Quote:
... iodoacetyl-7-nitrobenz-2-oxa-1,3-diazol (IA-NBD, Setareh Biotech) (42) ...
-
No products found
because this supplier's products are not listed.
Aminu S. Jahun, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... C-176 (Focus Biomolecules), or H-151 (Focus Biomolecules ...
-
No products found
because this supplier's products are not listed.
Wim J. de Jonge, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... by bead beating 7 times 3 minutes in a Genie Disruptor (Scientific Industries). The lysate was recovered and centrifuged at 1503g for 2 minutes at 4°C to remove cell debris ...
-
No products found
because this supplier's products are not listed.
Uddalak Majumdar, et al.,
bioRxiv - Cell Biology 2020
Quote:
... or 8-Br-PET-cGMP (cGMP analog: 0.025μM) (Axxora# BLG-P003-10), or WP1130 (Usp9x inhibitor ...
-
No products found
because this supplier's products are not listed.
Mariano R. Rodríguez-Sosa, et al.,
bioRxiv - Cell Biology 2023
Quote:
... ring artifact corrections and segmentation into binary images (8-bit BMP images) for the subsequent image processing ...
-
No products found
because this supplier's products are not listed.
In-Hyuk Jung, et al.,
bioRxiv - Genetics 2020
Quote:
... 50 µg ml-1 human medium oxidized low density lipoprotein (oxLDL, #770202-7, Kalen biomedical) was used.
-
No products found
because this supplier's products are not listed.
Chad Schimeck, et al.,
bioRxiv - Genomics 2022
Quote:
... The ready to use 5’-Cy3-labeled single strand telomeric probes (TTAGGG)7 (PNA Bio) were purchased from PNAGENE Inc (Daejeon ...
-
No products found
because this supplier's products are not listed.
Yoko Miura, et al.,
bioRxiv - Pathology 2021
Quote:
... rabbit anti-SP-C (Hycult Biotech), rat anti-Podoplanin (MBL) ...
-
No products found
because this supplier's products are not listed.
Jia J. Li, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... The samples were then transferred to an 8-strip tube (EpiCypher 10-0009). Each sample was incubated with 0.5 µg primary or IgG control antibody (Supplemental Table 5 ...
-
No products found
because this supplier's products are not listed.
Sanna Hellberg, et al.,
bioRxiv - Physiology 2020
Quote:
... and Phospholipids C kit (Fujifilm, Wako Diagnostics), respectively.
-
No products found
because this supplier's products are not listed.
Galit H. Frydman, et al.,
bioRxiv - Immunology 2019
Quote:
... 10 µL of cells were then imaged on a disposable C-Chip hemocytometer (In Cyto, SKC, Inc. C-Chip) using a 10X and 20X objective on a Nikon TiE fluorescent microscope ...
-
No products found
because this supplier's products are not listed.
Luisa de Lemos, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Fluoro-Jade C labelling was performed on retinal organoids cryosections using the Fluoro-Jade® C staining kit (Biosensis) and following the manufacturer’s instructions ...
-
No products found
Ashaq Hussain, Malay Kumar Ray,
bioRxiv - Microbiology 2022
Quote:
... syringae Lz4W was routinely grown at 22°C or 4°C (for optimum and low temperatures respectively) in Antarctic bacterial medium (ABM) composed of 5 g/l peptone and 2.0 g/l yeast extract ...
-
No products found
because this supplier's products are not listed.
Varun Kamat, et al.,
bioRxiv - Cell Biology 2021
Quote:
... The perifusion system consisted of an 8-channel peristaltic pump (MiniPuls 2, Gilson, Middleton, WI) connected to a 6-port valve (Part # V-451 ...
-
No products found
because this supplier's products are not listed.
Shahrnaz Kemal, et al.,
bioRxiv - Neuroscience 2023
Quote:
... All vectors contain an N-terminal 6x-His-tag, C terminal Strep-Tag II tag, with or without a N or C terminal fluorophore (EGFP, mNeonGreen (Allele Biotech), or mRuby2).
-
No products found
because this supplier's products are not listed.
Heon Shin, et al.,
bioRxiv - Molecular Biology 2023
Quote:
DNA damage was analyzed using EpiQuik 8-OHdG DNA Damage Quantification Direct Kit (P-6003, EpiGentek) according to the manufacturer’s protocol ...
-
No products found
because this supplier's products are not listed.
Xiufang Kong, Amr H Sawalha,
bioRxiv - Genetics 2019
Quote:
... on the Omega Lum C imaging system (Gel Company).
-
No products found
because this supplier's products are not listed.
Nicole Wagner, Mark P. Foster,
bioRxiv - Biochemistry 2021
Quote:
... pH 7) to a concentration of 25 μM and placed into a 1 mm path length quartz cuvette (Starna Cells). NMR buffer with no DNA was used as a blank ...
-
Cystatin-C ELISA / assay Kit
Cat# K012-H1,
1.0 ea, USD $385.0
Ask
Janine L. Brown, et al.,
bioRxiv - Zoology 2019
Quote:
... all samples were diluted (1:8) in assay buffer (Cat. No. X065, Arbor Assays, Arbor, MI, USA) and stored at –20°C until enzyme immunoassay (EIA ...
-
No products found
because this supplier's products are not listed.
Paola Bianchimano, et al.,
bioRxiv - Microbiology 2022
Quote:
... cecum was rapidly collected and resuspended in prereduced anaerobically sterilized saline and 100uL of 10−4 through 10−7 dilutions was plated on brucella blood agar (Anaerobe Systems) and incubated in an aerobic incubator ...
-
No products found
because this supplier's products are not listed.
Blandine Madji Hounoum, et al.,
bioRxiv - Cell Biology 2023
Quote:
... rinsed and postfixed in 1% osmium tetroxide and 1% potassium ferrocyanide in 0.1M cacodylate buffer before to processed for ultrastructure as previously described [7] and analyzed using a JEOL JEM1400 transmission electron microscope (JEOL, Tokyo, Japan).
-
No products found
because this supplier's products are not listed.
Robert Wimbish, et al.,
bioRxiv - Cell Biology 2019
Quote:
... Silanized coverslips were incubated with a rat anti-tubulin antibody (8 μg/ml, YL1/2; Accurate Chemical & Scientific Corporation) for 5 minutes ...
-
No products found
because this supplier's products are not listed.
Zachary B. Hancock, et al.,
bioRxiv - Evolutionary Biology 2020
Quote:
Whole genomic DNA was extracted from either the whole specimen or pereopods 6–7 depending on the size of the amphipod using an EZNA Tissue DNA kit (Omega Bio-tek Inc.) following manufacturer’s protocols ...
-
No products found
because this supplier's products are not listed.
Zsuzsa Radvanyi, et al.,
bioRxiv - Physiology 2023
Quote:
... The intact-FGF23 and c-terminal FGF23 were measured by ELISAs (Quidel, Cat ...
-
No products found
because this supplier's products are not listed.
Julia Fath, et al.,
bioRxiv - Cell Biology 2022
Quote:
... with 1 μM TAMRA-sheperdin-C-ter BDNF (TAMRA-KHSSGCAFLKKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France), or with TAMRA fluorophore alone for 20 minutes ...
-
No products found
because this supplier's products are not listed.
Vicki Mercado-Evans, et al.,
bioRxiv - Microbiology 2023
Quote:
... were grown to stationary phase at 37°C in Todd-Hewitt broth (Hardy Diagnostics) for at least 16 h ...
-
No products found
because this supplier's products are not listed.
Xiaoxuan Lin, et al.,
bioRxiv - Biophysics 2023
Quote:
... and hand-packing into a column (2 mm ID × 2 cm, IDEX C-130B). After digestion ...